Gene Information

Name : B1NLA3E_19605 (B1NLA3E_19605)
Accession : YP_007912164.1
Strain : Bacillus sp. 1NLA3E
Genome accession: NC_021171
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4227461 - 4228240 bp
Length : 780 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
TTGGTTGATTCACAGACTAGAAAAGGTTGGCGGAGATCGGCATGGTTACGGTATACGGGTTTATTTTATAAAAAAAGGGG
AGTTACTGGGGTGAAGAAGCGGATTTTGGTGGTTGAGGATGAGACTCAGATTGCGCGAGTGTTAAAGCTTGAGCTTGAAT
ATGAGGGTTATGAGGTTGAGTTGGCTTATAATGGGCGGTCTGGGTTGGAGCGGGCGTTGTCTGATGAGTTTGATTTGATT
CTGCTGGATGTGATGTTGCCGGAGTTAAATGGGATGGAAGTGCTACGGCGTTTGCGCAAGACATACAGCGCACTGCCAGT
GATTTTGTTGACGGCACGGGATTCCACCTTTGATAAAGTGAATGGATTGGATCAAGGTGCGAATGATTATATCACGAAGC
CGTTTGAGATTGAGGAGTTATTGGCGCGGGTTCGGTCTTGTTTTCGTCAGAAGGCGGTTGTGGATTCGGATGAGGGGTCC
TCAGAATTGGCGGTGCGCGATTTAACGCTTGTGTTGGATACCAGGGAAGTAAGGCGGGATAGAGTGTCGATTACGCTCAC
ACCAAAAGAGTATGATTTGTTGATGTATTTGATGATTAATAAAAATAAGGTGGTCACAAGGGAAAACATTCTTTTGCATG
TTTGGGGTTATGAGTATGAAGGAGAAACGAATGTTCTCGATGTTTATATTCGGCATTTACGGAAAAAAATCGATGACGAT
TTTTCCTTTCAGCTCATACAAACCGTTCGTGGGATTGGTTATTCGATTAGGGAGAAGTAA

Protein sequence :
MVDSQTRKGWRRSAWLRYTGLFYKKRGVTGVKKRILVVEDETQIARVLKLELEYEGYEVELAYNGRSGLERALSDEFDLI
LLDVMLPELNGMEVLRRLRKTYSALPVILLTARDSTFDKVNGLDQGANDYITKPFEIEELLARVRSCFRQKAVVDSDEGS
SELAVRDLTLVLDTREVRRDRVSITLTPKEYDLLMYLMINKNKVVTRENILLHVWGYEYEGETNVLDVYIRHLRKKIDDD
FSFQLIQTVRGIGYSIREK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-35 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-35 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_19605 YP_007912164.1 two-component response regulator HE999704.1.gene1528. Protein 2e-38 54
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-39 49
B1NLA3E_19605 YP_007912164.1 two-component response regulator AE015929.1.gene1106. Protein 4e-33 47
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0308 Protein 1e-32 45
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_012469.1.7685629. Protein 1e-34 44
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0125 Protein 9e-35 44
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0197 Protein 2e-35 44
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0083 Protein 3e-36 44
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0638 Protein 2e-31 44
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0111 Protein 5e-36 43
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_012469.1.7686381. Protein 3e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-27 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-36 42
B1NLA3E_19605 YP_007912164.1 two-component response regulator AE016830.1.gene1681. Protein 3e-36 41
B1NLA3E_19605 YP_007912164.1 two-component response regulator BAC0347 Protein 5e-33 41
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_002952.2859905.p0 Protein 8e-36 41
B1NLA3E_19605 YP_007912164.1 two-component response regulator NC_007622.3794472.p0 Protein 9e-36 41
B1NLA3E_19605 YP_007912164.1 two-component response regulator HE999704.1.gene2815. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_19605 YP_007912164.1 two-component response regulator VFG1390 Protein 4e-38 46
B1NLA3E_19605 YP_007912164.1 two-component response regulator VFG0596 Protein 1e-35 46
B1NLA3E_19605 YP_007912164.1 two-component response regulator VFG1386 Protein 1e-36 41