Gene Information

Name : B1NLA3E_02105 (B1NLA3E_02105)
Accession : YP_007908704.1
Strain : Bacillus sp. 1NLA3E
Genome accession: NC_021171
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 463145 - 463837 bp
Length : 693 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAAGGATCCTAATCATTGAAGATGAAGTAAGCATTGCTGAGCTGGAACGGGATTATTTGGAGATTAACGGCTTTCA
AACCGAAATAGTACTAACGGGAGATCTTGGATTACAGACTGCCCTGACAGGTGATTATGACTTAATTTTACTTGATGTCA
TGCTACCGAATATCGATGGTTTTGAAATATGCAAACGAGTTAGAAGTGTAAAGGATATTCCGATTATCTTAGTGACTGCT
AAAAAAGAAGAGATTGATAAAGTTCGTGGGCTAGGACTGGGCGCAGATGATTATTTAGTGAAGCCATTTAGCCCAAATGA
GATGGTTGCAAGAGTGAAGGCTCATTTGTCCAGATATGAACGGTTGCTAATGAGGCAAAAACCAGAATCCCATGAAATTT
ATATTCGTGGTTTAATCATAGATAGTTTATCACGACGAGTGTTTGTAAATAATCAAGAAGTAGTTTTCACGACAAAGGAA
TTTGATGTATTAACATTTTTAGCTATCCATCCCAATCAAGTTTTTAGTAAGGATCATTTATTTGAAAGAATTTGGGGTTA
TGACAGTTCGGGGGATGTATCTACCGTTACCGTTCATATTCGCAAGATCCGTGAAAAAATAGAGCACGATCCGTCAAATC
CGGATTATATTGAAACCGTTTGGGGCGCAGGCTACCGATTTAAGGAATCTTAG

Protein sequence :
MKRILIIEDEVSIAELERDYLEINGFQTEIVLTGDLGLQTALTGDYDLILLDVMLPNIDGFEICKRVRSVKDIPIILVTA
KKEEIDKVRGLGLGADDYLVKPFSPNEMVARVKAHLSRYERLLMRQKPESHEIYIRGLIIDSLSRRVFVNNQEVVFTTKE
FDVLTFLAIHPNQVFSKDHLFERIWGYDSSGDVSTVTVHIRKIREKIEHDPSNPDYIETVWGAGYRFKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-40 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-42 44
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator AE016830.1.gene1681. Protein 3e-42 44
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-39 44
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator AM180355.1.gene1830. Protein 2e-40 43
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 5e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator AE015929.1.gene1106. Protein 5e-33 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator HE999704.1.gene1528. Protein 4e-36 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 3e-41 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_012469.1.7685629. Protein 6e-39 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator CP004022.1.gene1676. Protein 7e-33 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator CP000034.1.gene2186. Protein 2e-31 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator NC_002695.1.916589.p Protein 2e-31 41
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator BAC0039 Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator VFG1563 Protein 5e-40 43
B1NLA3E_02105 YP_007908704.1 DNA-binding response regulator VFG1702 Protein 3e-39 42