Gene Information

Name : cadR (BTI_181)
Accession : YP_007916715.1
Strain :
Genome accession: NC_021173
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 208054 - 208485 bp
Length : 432 bp
Strand : -
Note : cadR-PbrR: Cd(II)/Pb(II)-responsive transcriptional regulator

DNA sequence :
ATGAAAATCGGCGAACTGGCGAAAGCGGCGCGGTGCACGCCCGAGACGATTCGTTTCTACGAAAAAGAGGGGCTGATGCC
CGACGCGGAACGGACCGATTCCAACTACCGCAACTACACCGACGCGCACGTCGAGCGGCTGCGCTTCATCCGGAACTGCC
GCGCGCTCGACATGACGCACGACGAGATCCGCGCACTGCTGCGCTTCACCGACGATCCGGCGGATCGCTGCGATTCGGTC
AACGCGCTGCTCGACGAACACATTGGTCACGTCAACACGCGGCTAGCCGAACTGCAGCACTTGCGCACACAGTTGATCGA
ATTGCGCGAGCGGTGCCAGGGCGAGCACGCGGTCGAGGATTGCGGGATCGTGCATGGCCTCGCGTCGATGGAAACGCCGG
ACATGCCGGGCAAGCGCACGCACGTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDAHVERLRFIRNCRALDMTHDEIRALLRFTDDPADRCDSV
NALLDEHIGHVNTRLAELQHLRTQLIELRERCQGEHAVEDCGIVHGLASMETPDMPGKRTHVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 4e-31 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 9e-34 50
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 6e-34 50
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 6e-34 50
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 8e-34 50
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-33 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-33 49
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-33 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cadR YP_007916715.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 2e-38 57
cadR YP_007916715.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 9e-32 55