Gene Information

Name : I872_05735 (I872_05735)
Accession : YP_007923389.1
Strain : Streptococcus oligofermentans AS 1.3089
Genome accession: NC_021175
Putative virulence/resistance : Virulence
Product : two-component response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1146970 - 1147671 bp
Length : 702 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAAAAATATTAGTTGTAGATGACGAGAAGCCAATCTCGGACATTATAAAGTTTAATATGACCAAGGAAGGTTATGA
AGTGCTGACTGCCTTTGATGGTAAGGAAGCCTTGGAAATGTTTGAAGTGGAGCAACCAGACATCTTGATTCTGGACTTGA
TGTTGCCAGAAGTGGATGGACTTGATGTTGCTCGGACCATTCGTAAGACCAGCAATGTTCCAATCATTGTGCTTTCGGCC
AAAGATAGCGAGTTCGATAAGGTAATCGGTCTGGAAATCGGTGCTGATGACTATGTGACCAAGCCCTTTTCAAATCGTGA
ATTGCTGGCTCGGGTCAAGGCCTTGCTGCGCCGTTCTGAACTCATCCCAGATAGTCATGTGGATGAGAGTAGTCCAAAGG
AATTGTTTATTGGAGATTTGCAGATTCTTCCAGATGCTTTTGTGGTGAAAAAACACGGGAAAGAATTGGAATTAACCCAT
CGTGAATTTGAACTCTTGCACCATTTGGCGACCCATGTCGGTCAAGTCATGACACGTGAACACTTACTAGAAACGGTCTG
GGGTTATGATTACTTCGGTGATGTGCGGACTGTTGATGTGACCATTCGTCGTCTGCGCGAAAAAATCGAAGATACTCCAA
GCCGTCCAGAGTACATCTTGACTCGCCGCGGTGTCGGTTATTACATAAGAAATAATGATTGA

Protein sequence :
MKKILVVDDEKPISDIIKFNMTKEGYEVLTAFDGKEALEMFEVEQPDILILDLMLPEVDGLDVARTIRKTSNVPIIVLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKALLRRSELIPDSHVDESSPKELFIGDLQILPDAFVVKKHGKELELTH
REFELLHHLATHVGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYIRNND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-38 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-38 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_012469.1.7685629. Protein 1e-91 82
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002952.2859905.p0 Protein 6e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_009641.5332272.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_013450.8614421.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_007793.3914279.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_007622.3794472.p0 Protein 5e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002745.1124361.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_009782.5559369.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002951.3237708.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_003923.1003749.p0 Protein 3e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002758.1121668.p0 Protein 4e-56 56
I872_05735 YP_007923389.1 two-component response transcriptional regulator HE999704.1.gene2815. Protein 2e-53 53
I872_05735 YP_007923389.1 two-component response transcriptional regulator AE016830.1.gene1681. Protein 4e-49 49
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_012469.1.7686381. Protein 1e-46 48
I872_05735 YP_007923389.1 two-component response transcriptional regulator AE015929.1.gene1106. Protein 4e-35 45
I872_05735 YP_007923389.1 two-component response transcriptional regulator AF155139.2.orf0.gene Protein 4e-41 45
I872_05735 YP_007923389.1 two-component response transcriptional regulator AM180355.1.gene1830. Protein 6e-39 44
I872_05735 YP_007923389.1 two-component response transcriptional regulator FJ349556.1.orf0.gene Protein 1e-40 44
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_014475.1.orf0.gen Protein 2e-39 43
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_005054.2598277.p0 Protein 2e-39 43
I872_05735 YP_007923389.1 two-component response transcriptional regulator AE000516.2.gene3505. Protein 8e-37 43
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_013450.8614146.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002951.3238224.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_007793.3914065.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002758.1121390.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_010079.5776364.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_002952.2859858.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_007622.3794948.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator NC_003923.1003417.p0 Protein 2e-39 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator AF162694.1.orf4.gene Protein 3e-34 42
I872_05735 YP_007923389.1 two-component response transcriptional regulator BAC0533 Protein 6e-32 41
I872_05735 YP_007923389.1 two-component response transcriptional regulator DQ212986.1.gene4.p01 Protein 6e-37 41
I872_05735 YP_007923389.1 two-component response transcriptional regulator CP000647.1.gene4257. Protein 6e-32 41
I872_05735 YP_007923389.1 two-component response transcriptional regulator CP001138.1.gene4273. Protein 6e-32 41
I872_05735 YP_007923389.1 two-component response transcriptional regulator CP001918.1.gene5135. Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I872_05735 YP_007923389.1 two-component response transcriptional regulator VFG1563 Protein 2e-38 44
I872_05735 YP_007923389.1 two-component response transcriptional regulator VFG1389 Protein 7e-33 44
I872_05735 YP_007923389.1 two-component response transcriptional regulator VFG1702 Protein 2e-38 43
I872_05735 YP_007923389.1 two-component response transcriptional regulator VFG1390 Protein 4e-38 41
I872_05735 YP_007923389.1 two-component response transcriptional regulator VFG0596 Protein 3e-34 41