Gene Information

Name : TY21A_07905 (TY21A_07905)
Accession : YP_007925873.1
Strain : Salmonella enterica Ty21a
Genome accession: NC_021176
Putative virulence/resistance : Resistance
Product : putative multidrug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1614845 - 1615183 bp
Length : 339 bp
Strand : -
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGACTAAAGAAGCTGTAATCTTTCTATTTATCGCCATCGTGGTAGAAGTTATCGCCACGATCTCATTAAAATTATCGGA
TAGTTTTACGCGTCTGGTACCGAGCCTCGTTACCATCATCGGATATTGTATCGCGTTCTGGTGCCTTACCATCCCTATGC
GAACCATCCCTGCGGGTATCATTTATGCCATTTGGTCTGGGGTAGGGATTGTTCTTATTGGATTGATAGGATGGCTGTTT
CTTGGCCAAAAATTGGATGTGCCGGCTATTATTGGCATGTTGCTTATCATCTGCGGTGTAATCGTAATCAATCTGTTTTC
AAAAAGCGTCAGTCACTAG

Protein sequence :
MTKEAVIFLFIAIVVEVIATISLKLSDSFTRLVPSLVTIIGYCIAFWCLTIPMRTIPAGIIYAIWSGVGIVLIGLIGWLF
LGQKLDVPAIIGMLLIICGVIVINLFSKSVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 6e-10 56
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 6e-10 56
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 8e-10 56
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 6e-10 56
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-10 56
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 8e-10 56
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-10 56
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 8e-10 56
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-10 56
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 8e-10 56
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 6e-10 56
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-10 56
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 8e-10 56
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 6e-10 56
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 6e-10 56
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 6e-10 56
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 6e-10 56
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 6e-10 56
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 6e-10 56
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 6e-10 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TY21A_07905 YP_007925873.1 putative multidrug transporter CP001138.1.gene1489. Protein 1e-34 99
TY21A_07905 YP_007925873.1 putative multidrug transporter NC_002695.1.913273.p Protein 2e-14 58
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0150 Protein 2e-14 58
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0322 Protein 8e-15 56
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0324 Protein 2e-13 56
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0377 Protein 3e-17 56
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0323 Protein 3e-10 56
TY21A_07905 YP_007925873.1 putative multidrug transporter CP004022.1.gene1549. Protein 2e-18 54
TY21A_07905 YP_007925873.1 putative multidrug transporter NC_010410.6003348.p0 Protein 9e-11 52
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0002 Protein 9e-11 52
TY21A_07905 YP_007925873.1 putative multidrug transporter BAC0139 Protein 3e-07 43