Gene Information

Name : SFUL_3399 (SFUL_3399)
Accession : YP_007932213.1
Strain : Streptomyces fulvissimus DSM 40593
Genome accession: NC_021177
Putative virulence/resistance : Resistance
Product : Two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3859328 - 3860227 bp
Length : 900 bp
Strand : -
Note : UniProt-pubmed:11572948; UniProt-pubmed:17369815; gene_name:resD; UniProt-pubmed:21463507; UniProt-pubmed:21551298; UniProt-pubmed:12000953; UniProt-pubmed:20064060; UniProt-pubmed:17194220

DNA sequence :
GTGGACGCCATGGAGAACTCCCCGTCCGCCCCGCCCCACGCACCCGCCCCCGAGGGCAGGCGCGGCCGGGTCCTCGTCGT
GGACGACGACCCGACCGTGGCCGAGGTCGTCGTCGGCTATCTGCACCGTGCCGGGTACGCCGTCGAGCGGGCCGGGGACG
GGCCCGCCGCTCTGGAACGGTTCGCGGCGGCCCGGCCCGACCTCGTCGTCCTGGACCTGATGCTGCCCGCCATGGACGGG
TTCGAGGTCTGCCGCCGGATGCGCGCGCACGGGCCGGTCCCGGTCATCATGCTCACCGCACGCGGCGACGAGGAGGACCG
CATCCTCGGCCTGGAGACCGGGGCCGACGACTACGTCACCAAGCCGTTCAGCCCGCGTGAACTGGTGCTGCGGGTCGAGT
CCGTACTGCGCCGCGCCGGGGCCGGGACGCCCGCCGCCGAGGAGGCCCGCCCCCTGTCGGGCGCCGGACTGCGCCTGGAC
CCGGTGGCCCGCAGCGCTTCCCGCGACGGGGCCGGACTCGCCCTGACCCTGCGGGAGTTCGACCTGCTCGCCTTCCTTCT
CCGGCATCCCGGGCGGGCGTTCGGCCGGGAGGAGCTGATGCGGGAGGTCTGGGGCTGGGACTTCGGCGACCTGTCCACGG
TCACCGTCCACATCCGCAGGCTGCGGGGCAAGGTCGAACAGGACCCGGCACGGCCCCGGTTGATCCGTACGGTGTGGGGG
GTGGGGTACCGCCTGGACCTCCCGGGCGACGGGGAGGCCGGGGAGGCCGGGGAGGCTGCGGGGGCCACGGGGGCCACGGG
GGCCCCTGAGTCCCCTGAGGCCATGAGGGCCATAGAGGCCTCTGAGGCCCCTGAGGCTCCTGGGACCACTGACCGTACGG
CGGGGGCACCCCGTGCGTGA

Protein sequence :
MDAMENSPSAPPHAPAPEGRRGRVLVVDDDPTVAEVVVGYLHRAGYAVERAGDGPAALERFAAARPDLVVLDLMLPAMDG
FEVCRRMRAHGPVPVIMLTARGDEEDRILGLETGADDYVTKPFSPRELVLRVESVLRRAGAGTPAAEEARPLSGAGLRLD
PVARSASRDGAGLALTLREFDLLAFLLRHPGRAFGREELMREVWGWDFGDLSTVTVHIRRLRGKVEQDPARPRLIRTVWG
VGYRLDLPGDGEAGEAGEAAGATGATGAPESPEAMRAIEASEAPEAPGTTDRTAGAPRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-37 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_3399 YP_007932213.1 Two-component system response regulator AE000516.2.gene3505. Protein 4e-43 46
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_012469.1.7685629. Protein 1e-46 46
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_002952.2859905.p0 Protein 1e-48 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_009641.5332272.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_013450.8614421.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_007793.3914279.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_007622.3794472.p0 Protein 9e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_002745.1124361.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_009782.5559369.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_002951.3237708.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_003923.1003749.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator NC_002758.1121668.p0 Protein 7e-49 45
SFUL_3399 YP_007932213.1 Two-component system response regulator BAC0197 Protein 3e-33 42
SFUL_3399 YP_007932213.1 Two-component system response regulator CP000034.1.gene3671. Protein 7e-43 42
SFUL_3399 YP_007932213.1 Two-component system response regulator AF310956.2.orf0.gene Protein 9e-38 41
SFUL_3399 YP_007932213.1 Two-component system response regulator U35369.1.gene1.p01 Protein 7e-37 41
SFUL_3399 YP_007932213.1 Two-component system response regulator AE016830.1.gene2255. Protein 7e-37 41
SFUL_3399 YP_007932213.1 Two-component system response regulator BAC0125 Protein 5e-33 41
SFUL_3399 YP_007932213.1 Two-component system response regulator CP000647.1.gene2531. Protein 4e-37 41
SFUL_3399 YP_007932213.1 Two-component system response regulator HE999704.1.gene2815. Protein 1e-45 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFUL_3399 YP_007932213.1 Two-component system response regulator VFG1390 Protein 4e-38 45
SFUL_3399 YP_007932213.1 Two-component system response regulator VFG1389 Protein 1e-31 43
SFUL_3399 YP_007932213.1 Two-component system response regulator VFG0596 Protein 8e-31 42
SFUL_3399 YP_007932213.1 Two-component system response regulator VFG1563 Protein 2e-38 42
SFUL_3399 YP_007932213.1 Two-component system response regulator VFG1386 Protein 2e-35 42
SFUL_3399 YP_007932213.1 Two-component system response regulator VFG1702 Protein 1e-37 41