Gene Information

Name : Desgi_0571 (Desgi_0571)
Accession : YP_007943809.1
Strain : Desulfotomaculum gibsoniae DSM 7213
Genome accession: NC_021184
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 555731 - 556408 bp
Length : 678 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGAATGAGAAGATTCTCCTCATTGAAGATGAGGAAAAACTAGCCCGGTTTATTGAGATGGAGCTATTATACGAAGGATA
TAAAGTGGAAAAAGCTTACGACGGCCGAATTGGTTTGGATTTGGCTTTGGCCGGCTCCTTTGACATTGTGATCCTGGACA
TTATGCTGCCCGGCTTGAACGGCATGGAGGTACTTCGGCGTATTCGCAGAAGTTCCTCCATGCCGGTTATAATGTTGACT
GCCCGTGATACCACCGTGGATAAGGTCACGGGCTTGGATAGCGGCGCGGATGATTATCTGACCAAACCTTTTGCCATAGA
AGAACTGCTGGCGCGAATTCGTAACGCATTGCGGAAAAAAGTGAACGTAACGATGGTCAAAAGCTTATCCGCTTGTGGTC
TCACCCTGGATATAGAACGACATTTGGCGGCGGTAAACAATGTTGCTATAGAGTTAACCAAAAAGGAATTTAGCCTGCTG
CAATTTCTCCTTGAAAATAAAGGAATTGTTTTAACCCGTGAAACTTTACTGGAGAAAGTATGGGGTTTTGACTATACGGG
AGATACAAATACCATAGACGTTTATGTCCGTTATTTACGTTCTAAGATTGATGAACCTTTCGGGATCAAACTTATTCACA
CCGTCCGTGGAGTGGGGTATGTGATTAGAGATGAATGA

Protein sequence :
MNEKILLIEDEEKLARFIEMELLYEGYKVEKAYDGRIGLDLALAGSFDIVILDIMLPGLNGMEVLRRIRRSSSMPVIMLT
ARDTTVDKVTGLDSGADDYLTKPFAIEELLARIRNALRKKVNVTMVKSLSACGLTLDIERHLAAVNNVAIELTKKEFSLL
QFLLENKGIVLTRETLLEKVWGFDYTGDTNTIDVYVRYLRSKIDEPFGIKLIHTVRGVGYVIRDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-43 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-43 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 6e-48 52
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-42 51
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 1e-45 50
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 3e-40 46
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 1e-37 45
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-31 45
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 1e-36 44
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 1e-39 44
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 6e-39 44
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 3e-35 44
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 4e-42 43
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 5e-36 43
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 5e-25 43
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 8e-32 42
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 8e-32 42
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP004022.1.gene3215. Protein 5e-25 42
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001485.1.gene721.p Protein 1e-28 41
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 3e-36 41
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 3e-30 41
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000675.2.gene1535. Protein 2e-30 41
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-34 41
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain U82965.2.orf14.gene. Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 6e-44 47
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 4e-42 47
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 1e-40 44
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0473 Protein 9e-28 42
Desgi_0571 YP_007943809.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 1e-36 41