Gene Information

Name : L083_3398 (L083_3398)
Accession : YP_007951388.1
Strain : Actinoplanes sp. N902-109
Genome accession: NC_021191
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4057541 - 4058224 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
GTGGCTCGAGTCCTGGTCGTCGATGACGATCCTACCGTCAGCGATGTCGTGCGTCGTTACCTGGAACAGGACGGTTGTGA
GGTGCGGCTGGCCGGGGACGGGCATGCCGCCCTCGCCGCCGTCGCGGCTGAGCGTCCCGATCTGGTCGTGCTCGATCTGA
TGATGCCGGGGCTGGACGGTCTCGAGGTGTGCCGCCGGTTACGGGCCCGGATGCCGGAGTTGCCGGTGGTGATGCTCACC
GCGCTGGGTGAGGAGGACGACCGGGTCGCCGGGCTGGAGCTGGGGGCCGACGACTACGTCACCAAGCCGTTCTCGCCGCG
GGAGCTGGTGCTGCGCATCCGTTCGGTGCTGCGGCGCAGCGCCCCCGCGGCCGGGCCGGTGCTGCTGCGGGACGGTGATC
TGGTCGCCGACACCGCCCGCCGGGTGGCCCAGCTGGCCGGGGAGCCGCTCGCGTTGACCGTACGGGAGTTCGATCTGCTG
GCTTTCCTGATCGCCCACCCGGGGCGGGCGTGGTCCCGGGCCGAGCTGCTGGCCGAGGTGTGGGGCTGGCAGTTCGGCGA
CCAGTCCACGGTGACGGTGCATGTGCGGCGGTTGCGGGAGAAGATCGAGGCCGATCCGGCCCGGCCGCGGCGGTTGCTCA
CCGCGTGGGGTGTCGGCTACCGGTACGAGCTGGCCGGCTCATGA

Protein sequence :
MARVLVVDDDPTVSDVVRRYLEQDGCEVRLAGDGHAALAAVAAERPDLVVLDLMMPGLDGLEVCRRLRARMPELPVVMLT
ALGEEDDRVAGLELGADDYVTKPFSPRELVLRIRSVLRRSAPAAGPVLLRDGDLVADTARRVAQLAGEPLALTVREFDLL
AFLIAHPGRAWSRAELLAEVWGWQFGDQSTVTVHVRRLREKIEADPARPRRLLTAWGVGYRYELAGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-29 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-29 44
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-18 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-29 48
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-31 46
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-23 45
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-29 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-29 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-30 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-21 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-21 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-21 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-21 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-21 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-22 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 7e-21 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-19 43
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-17 42
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-31 42
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-19 42
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-23 41
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-26 48
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-29 45
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-29 44
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-22 43
L083_3398 YP_007951388.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-19 42