Gene Information

Name : L083_8108 (L083_8108)
Accession : YP_007956098.1
Strain : Actinoplanes sp. N902-109
Genome accession: NC_021191
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 9111749 - 9112429 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
GTGAACGCGCGGACGATCCTGGTGGTCGAGGACGAGCCGACCATCGCCGACGCCGTGTCGGCCCGGCTGCGGGCCGAGGG
ATTCGTGGTCGAGCTGGTCGCCGACGGTCCGGGCGCGGTCGAGGCGGCCCGGCGGGTGCAGCCGGACGCCATCGTGCTGG
ACGTCATGCTGCCCGGTTTCGACGGGCTGGAGGTGTGCCGGCGGGTGCAGGCCGAGCGGCCCGTGCCCGTCCTCATGCTC
ACCGCCCGCGACGACGAGACCGACCTGCTCGTCGGGCTGGCCGTCGGCGCCGACGACTACCTGACCAAACCGTTCTCCAT
GCGCGAGCTCACCGCACGGCTGCACGCGCTGCTGCGCCGGGTGAACCGGAGCGCCGCGCCCGCCGTCCCCGCACCGCTGC
GGTTCGGCGATCTGGAGATCAACCTGGCCGAGCGCCGGGTGCATCGCGGCGGGGTCGAGGCGCGCCTCACGCCCACCGAG
TTCGACCTGCTGGCGCATCTGGCCGCCCATGCGCGCACGGTCCTGCCCCGGGAACGGCTGCTCGCCGACATCTGGGGCTG
GGCCGACGCCTCGGGCACCCGCACGGTCGACAGCCACATCAAGGGGCTGCGGCGCAAGCTCGGTGCCGACCTGATCCGCA
CGGTGCACGGCGTCGGCTACGCGCTCGAGGTGGCCCGGTGA

Protein sequence :
MNARTILVVEDEPTIADAVSARLRAEGFVVELVADGPGAVEAARRVQPDAIVLDVMLPGFDGLEVCRRVQAERPVPVLML
TARDDETDLLVGLAVGADDYLTKPFSMRELTARLHALLRRVNRSAAPAVPAPLRFGDLEINLAERRVHRGGVEARLTPTE
FDLLAHLAAHARTVLPRERLLADIWGWADASGTRTVDSHIKGLRRKLGADLIRTVHGVGYALEVAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-23 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 8e-39 44
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family BAC0083 Protein 4e-34 43
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family BAC0197 Protein 9e-32 42
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-38 42
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-32 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-36 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-35 41
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-32 45
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-41 44
L083_8108 YP_007956098.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-29 41