Gene Information

Name : J113_06320 (J113_06320)
Accession : YP_007960808.1
Strain : Mycobacterium tuberculosis CAS/NITR204
Genome accession: NC_021193
Putative virulence/resistance : Virulence
Product : two component response transcriptionalregulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1002853 - 1003563 bp
Length : 711 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGGCGGCATGGACACTGGTGTGACCTCACCTCGGGTGTTGGTCGTCGACGACGACTCCGATGTGCTCGCCTCGCTGGA
ACGCGGCTTACGGCTGTCCGGATTCGAGGTAGCGACCGCGGTGGACGGCGCCGAGGCCTTGCGCAGCGCCACCGAGAACC
GGCCGGACGCGATCGTGCTCGACATCAACATGCCAGTGCTCGATGGAGTCAGCGTCGTGACGGCACTACGCGCGATGGAC
AACGACGTCCCGGTCTGTGTGCTATCCGCACGCAGCTCTGTCGATGACCGAGTGGCCGGATTGGAGGCCGGCGCCGACGA
TTACCTGGTGAAACCGTTCGTGCTGGCCGAGCTGGTGGCACGGGTGAAGGCGCTGCTGCGCCGCCGCGGCTCCACTGCAA
CGTCGTCCTCGGAAACCATCACGGTGGGCCCGCTGGAGGTGGACATCCCCGGCCGGCGGGCCCGGGTCAACGGCGTCGAC
GTCGACCTGACCAAGCGCGAATTCGACCTGCTCGCGGTGCTGGCCGAGCACAAGACCGCGGTGCTCTCCCGAGCGCAACT
CCTGGAATTGGTGTGGGGCTACGACTTCGCCGCCGACACCAACGTGGTGGACGTCTTCATCGGGTACCTGCGGCGCAAAC
TGGAGGCCGGCGGTGGCCCTAGGCTGCTGCATACCGTCCGCGGAGTCGGATTCGTGCTGCGTATGCAGTGA

Protein sequence :
MGGMDTGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMD
NDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTATSSSETITVGPLEVDIPGRRARVNGVD
VDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0083 Protein 5e-31 46
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0125 Protein 7e-30 43
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein HE999704.1.gene1528. Protein 2e-31 43
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0197 Protein 6e-25 43
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0638 Protein 4e-24 43
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_012469.1.7685629. Protein 4e-28 43
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein AE000516.2.gene3505. Protein 6e-29 43
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0308 Protein 1e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_002952.2859905.p0 Protein 2e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_007793.3914279.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_002745.1124361.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_007622.3794472.p0 Protein 2e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_009782.5559369.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_002951.3237708.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_003923.1003749.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_002758.1121668.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_009641.5332272.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_013450.8614421.p0 Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein HE999704.1.gene2815. Protein 3e-27 42
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0347 Protein 8e-24 41
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein BAC0111 Protein 5e-26 41
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_012469.1.7686381. Protein 2e-23 41
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein NC_002516.2.879194.p Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein VFG1389 Protein 1e-87 100
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein VFG1390 Protein 2e-41 50
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein VFG1386 Protein 1e-36 46
J113_06320 YP_007960808.1 two component response transcriptionalregulatory protein VFG0596 Protein 7e-26 42