Gene Information

Name : Tmari_1664 (Tmari_1664)
Accession : YP_007978013.1
Strain : Thermotoga maritima MSB8
Genome accession: NC_021214
Putative virulence/resistance : Virulence
Product : Response regulator DrrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1644650 - 1645369 bp
Length : 720 bp
Strand : -
Note : Corresponds to TM1655

DNA sequence :
ATGGCGAAAAAGAAGATTCTGGTGGTTGACGACGACCCGGCAATTCTTGAGCTGGTAGGATATAACCTTTCCAAGGAAGG
ATACGAGGTGCTCAAGGCTTATGATGGAGAGGAAGCACTCAAAATTGCCAACGACGAAGACGTGGACATGTTCATAGTGG
ATATCATGCTTCCTGGAATCGACGGCTTCGAGCTGGTCAGGAAGATCAGATCCATGGAGAAATACAAGAACACCCCCGTG
ATCTTCCTGAGCGCAAAGGGAGAAGAATTCGACAAGGTGCTTGGGCTGGAGCTCGGTGCGGACGACTACATCACCAAGCC
GTTCAGCGTGAGAGAGCTTCTTGCGAGGGTGAAGGCTATATTCAGAAGGCTTTCCACCGCTACTCAGAGCAAGGAAGAAA
GGCCTAAGAAGATCATAGCCAAGGATCTTGAAATCGATGTGGAAAAGTACGAAGTGAAAGTGAGAGGGAAAAAAGTGAAC
CTCACTCCTCTCGAATTTGAACTGCTCCGATTCCTCGCGGAAAACGAAGGAAAAGTTTTCAGCAGGGATGTTCTTCTGGA
CAAACTCTGGGGATACGATTACTACGGAGATACGAGAACTGTAGATGTTCACATAAGAAGGCTGAGAACGAAGATAGAAG
AAGATCCTTCGAATCCGAAATACATAATCACTGTGAGAGGAAAGGGATACAAATTCAGAGACCCCGGAAAGGAAGACTGA

Protein sequence :
MAKKKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGFELVRKIRSMEKYKNTPV
IFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRRLSTATQSKEERPKKIIAKDLEIDVEKYEVKVRGKKVN
LTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKFRDPGKED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-44 48
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-44 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_012469.1.7685629. Protein 3e-54 52
Tmari_1664 YP_007978013.1 Response regulator DrrA HE999704.1.gene2815. Protein 1e-49 51
Tmari_1664 YP_007978013.1 Response regulator DrrA AE016830.1.gene1681. Protein 3e-54 49
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002952.2859905.p0 Protein 2e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002951.3237708.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_007622.3794472.p0 Protein 2e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002758.1121668.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_009641.5332272.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_013450.8614421.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_007793.3914279.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_003923.1003749.p0 Protein 4e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002745.1124361.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_009782.5559369.p0 Protein 3e-49 48
Tmari_1664 YP_007978013.1 Response regulator DrrA AF155139.2.orf0.gene Protein 9e-47 47
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_012469.1.7686381. Protein 2e-46 47
Tmari_1664 YP_007978013.1 Response regulator DrrA AM180355.1.gene1830. Protein 5e-42 46
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_014475.1.orf0.gen Protein 2e-45 45
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_005054.2598277.p0 Protein 2e-45 45
Tmari_1664 YP_007978013.1 Response regulator DrrA AE000516.2.gene3505. Protein 2e-40 44
Tmari_1664 YP_007978013.1 Response regulator DrrA FJ349556.1.orf0.gene Protein 8e-44 43
Tmari_1664 YP_007978013.1 Response regulator DrrA DQ212986.1.gene4.p01 Protein 3e-41 43
Tmari_1664 YP_007978013.1 Response regulator DrrA AF130997.1.orf0.gene Protein 5e-38 43
Tmari_1664 YP_007978013.1 Response regulator DrrA AF162694.1.orf4.gene Protein 1e-38 43
Tmari_1664 YP_007978013.1 Response regulator DrrA BAC0125 Protein 2e-34 42
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002758.1121390.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_010079.5776364.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002952.2859858.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_007622.3794948.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_003923.1003417.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_013450.8614146.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_002951.3238224.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA NC_007793.3914065.p0 Protein 5e-36 41
Tmari_1664 YP_007978013.1 Response regulator DrrA BAC0197 Protein 2e-33 41
Tmari_1664 YP_007978013.1 Response regulator DrrA EU250284.1.orf4.gene Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmari_1664 YP_007978013.1 Response regulator DrrA VFG1702 Protein 1e-44 48
Tmari_1664 YP_007978013.1 Response regulator DrrA VFG1563 Protein 3e-44 47
Tmari_1664 YP_007978013.1 Response regulator DrrA VFG1389 Protein 9e-34 43
Tmari_1664 YP_007978013.1 Response regulator DrrA VFG1386 Protein 2e-38 41