Gene Information

Name : rrp5 (LBP_cg1141)
Accession : YP_007986818.1
Strain : Lactobacillus plantarum P-8
Genome accession: NC_021224
Putative virulence/resistance : Virulence
Product : Response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1230514 - 1231041 bp
Length : 528 bp
Strand : +
Note : -

DNA sequence :
ATGTTACCGGAACTGAACGGTTTGGAAGTCTGCCGGCGGGTTCGTGAAGTCAAGAATACGCCGATTATTATGATGACGGC
CCGTGACTCCGTGATTGATCGAGTTTCCGGCCTGGATCATGGGGCAGATGATTACATTGTTAAGCCATTTGCTATCGAAG
AATTACTTGCCCGCTTACGAGCACTATTGCGGCGAATCGATTTGGAAAGTGAACAACAAAGCACTAAACAAACGACCGTC
ACTTATAAAGACTTGACGATTGAAAAGGAAAACTTAGTCGTTAAACGCGGCGACGAAGTCATCAACTTGACGAAGCGTGA
ATATGAACTGTTATTAACTTTAATGGAAAATATTAACGTTGTCCTCGCTCGTGATGTCTTACTAAACAAAGTATGGGGTT
ACGAATCAGAAGTTGAAACGAATGTCGTCGACGTTTATATCCGTTACTTACGGAACAAGATTGACCGACCAGGAGAAAAG
AGTTACATCCAAACTGTTCGTGGGACTGGATACGTGATTCGTTCTTAA

Protein sequence :
MLPELNGLEVCRRVREVKNTPIIMMTARDSVIDRVSGLDHGADDYIVKPFAIEELLARLRALLRRIDLESEQQSTKQTTV
TYKDLTIEKENLVVKRGDEVINLTKREYELLLTLMENINVVLARDVLLNKVWGYESEVETNVVDVYIRYLRNKIDRPGEK
SYIQTVRGTGYVIRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-23 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp5 YP_007986818.1 Response regulator HE999704.1.gene1528. Protein 2e-60 80
rrp5 YP_007986818.1 Response regulator NC_002951.3238224.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_007793.3914065.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_002758.1121390.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_010079.5776364.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_002952.2859858.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_007622.3794948.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_003923.1003417.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator NC_013450.8614146.p0 Protein 6e-35 54
rrp5 YP_007986818.1 Response regulator AE015929.1.gene1106. Protein 3e-31 52
rrp5 YP_007986818.1 Response regulator BAC0125 Protein 3e-22 45
rrp5 YP_007986818.1 Response regulator AE000516.2.gene3505. Protein 1e-25 43
rrp5 YP_007986818.1 Response regulator BAC0083 Protein 2e-21 42
rrp5 YP_007986818.1 Response regulator NC_012469.1.7686381. Protein 4e-26 42
rrp5 YP_007986818.1 Response regulator BAC0197 Protein 2e-21 42
rrp5 YP_007986818.1 Response regulator NC_002952.2859905.p0 Protein 5e-24 42
rrp5 YP_007986818.1 Response regulator NC_002745.1124361.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_009782.5559369.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_002951.3237708.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_002758.1121668.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_009641.5332272.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_013450.8614421.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_007793.3914279.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_007622.3794472.p0 Protein 6e-24 42
rrp5 YP_007986818.1 Response regulator NC_003923.1003749.p0 Protein 5e-24 42
rrp5 YP_007986818.1 Response regulator BAC0308 Protein 1e-20 41
rrp5 YP_007986818.1 Response regulator BAC0638 Protein 2e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp5 YP_007986818.1 Response regulator VFG1390 Protein 5e-32 48
rrp5 YP_007986818.1 Response regulator VFG0596 Protein 3e-24 42
rrp5 YP_007986818.1 Response regulator VFG1389 Protein 5e-27 42
rrp5 YP_007986818.1 Response regulator VFG1702 Protein 9e-22 41