Gene Information

Name : KPR_2492 (KPR_2492)
Accession : YP_007991471.1
Strain : Klebsiella pneumoniae SB3432
Genome accession: NC_021232
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2584899 - 2585759 bp
Length : 861 bp
Strand : -
Note : highly similar to beta-lactamase SHV-1 from Klebsiella pneumoniae (sp|P0AD64)

DNA sequence :
ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGA
GCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGA
CCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTG
GATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAA
ACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGC
TGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGC
TGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCG
CAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCG
GACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGG
ATTGTCGCCCTGCTTGGCCTGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGC
CGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA

Protein sequence :
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARV
DAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDR
WETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGLNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaTEM-1b ACK44542.1 BlaTEM-1b beta lactamase Not tested SGI1 Protein 7e-93 66
blaTEM-1b ACF06168.1 beta-lactamase TEM-1b Not tested Tn5036-like Protein 7e-93 66
blaTEM-1 ADI24150.1 beta-lactamase TEM-1 Not tested AbaR1 Protein 7e-93 66
blaTEM-1b AGK07035.1 TEM-1b beta lactamase Not tested SGI1 Protein 7e-93 66
blaTEM-1b AGK07093.1 TEM-1b beta lactamase Not tested SGI1 Protein 7e-93 66
ABTW07_3874 YP_005797122.1 beta-lactamase TEM Not tested AbaR4e Protein 9e-93 66
blaTEM AFV53104.1 TEM-1 beta-lactamase Not tested AbGRI2-1 Protein 7e-93 66
pse-1 AGK06978.1 PSE-1 beta-lactamase Not tested SGI1 Protein 2e-52 45
pse-1 AGK07108.1 PSE-1 beta-lactamase Not tested SGI1 Protein 2e-52 45
pse-1 AAK02055.1 beta-lactamase Not tested SGI1 Protein 2e-52 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KPR_2492 YP_007991471.1 hypothetical protein X98102.1.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ193536.1.gene1.p01 Protein 5e-129 99
KPR_2492 YP_007991471.1 hypothetical protein GQ428198.1.gene1.p01 Protein 1e-128 99
KPR_2492 YP_007991471.1 hypothetical protein DQ174305.1.gene1.p01 Protein 3e-130 99
KPR_2492 YP_007991471.1 hypothetical protein EU155018.1.gene1.p01 Protein 7e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AM176555.2.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EU586041.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF208796.2.gene1.p01 Protein 6e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ174307.1.gene1.p01 Protein 3e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AM176550.2.gene1.p01 Protein 5e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AM176558.2.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein JQ029959.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AB551737.1.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ013287.1.gene1.p1 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein HM559945.1.gene1.p01 Protein 1e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AM087453.1.gene1.p01 Protein 2e-125 99
KPR_2492 YP_007991471.1 hypothetical protein EU032604.1.gene1.p01 Protein 7e-130 99
KPR_2492 YP_007991471.1 hypothetical protein CP000647.1.gene1607. Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176552.2.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY790341.1.gene1.p01 Protein 6e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EU684753.1.gene1.p01 Protein 2e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AY288915.1.gene1.p01 Protein 4e-130 99
KPR_2492 YP_007991471.1 hypothetical protein EU274581.1.gene1.p1 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein JQ388884.1.gene1.p1 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176551.2.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein HQ637576.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ174306.1.gene1.p01 Protein 9e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176553.2.gene1.p01 Protein 7e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AY518560.gene.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176547.2.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EF373969.1.gene1.p01 Protein 5e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ174304.1.gene1.p01 Protein 2e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AY590467.1.gene1.p1 Protein 1e-106 99
KPR_2492 YP_007991471.1 hypothetical protein AF148850.1.gene1.p01 Protein 4e-130 99
KPR_2492 YP_007991471.1 hypothetical protein JF812965.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ174308.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176554.2.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein JN051143.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF467948.1.gene1.p1 Protein 8e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EU024485.1.gene1.p01 Protein 6e-130 99
KPR_2492 YP_007991471.1 hypothetical protein EF373972.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EF373971.1.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF547625.1.gene1.p1 Protein 5e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AJ866284.2.gene1.p01 Protein 1e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AF317502.gene.p01 Protein 2e-117 99
KPR_2492 YP_007991471.1 hypothetical protein AF227204.1.gene1.p01 Protein 3e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AF293345.1.gene1.p01 Protein 8e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AM176549.2.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein JX013655.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY289548.1.gene1.p01 Protein 7e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EU418913.1.gene1.p01 Protein 4e-128 99
KPR_2492 YP_007991471.1 hypothetical protein U92041.1.gene1.p01 Protein 5e-130 99
KPR_2492 YP_007991471.1 hypothetical protein EF373973.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ054528.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176556.2.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein HQ877615.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein HQ661362.1.gene1.p1 Protein 1e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AJ920369.1.gene1.p01 Protein 6e-125 99
KPR_2492 YP_007991471.1 hypothetical protein AB023477.1.gene1.p01 Protein 7e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AF535129.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein HM751100.1.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176546.2.gene1.p01 Protein 6e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ328802.1.gene1.p01 Protein 2e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AY263404.1.gene1.p1 Protein 4e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AY528718.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176557.2.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY210887.1.gene1.p1 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY259119.1.gene1.p1 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ836922.1.gene1.p01 Protein 1e-128 99
KPR_2492 YP_007991471.1 hypothetical protein AB733453.1.gene1.p01 Protein 4e-126 99
KPR_2492 YP_007991471.1 hypothetical protein AF148851.1.gene1.p01 Protein 7e-130 99
KPR_2492 YP_007991471.1 hypothetical protein JX268752.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein EF373970.1.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY070258.1.gene1.p1 Protein 5e-129 99
KPR_2492 YP_007991471.1 hypothetical protein U20270.1.gene1.p01 Protein 2e-128 99
KPR_2492 YP_007991471.1 hypothetical protein EU342351.1.gene1.p01 Protein 4e-130 99
KPR_2492 YP_007991471.1 hypothetical protein JX268631.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF467947.1.gene1.p1 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein DQ322460.1.gene1.p1 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF226622.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY661885.1.gene1.p01 Protein 8e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF299299.1.gene1.p01 Protein 6e-130 99
KPR_2492 YP_007991471.1 hypothetical protein X55640.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF164577.1.gene1.p01 Protein 3e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY277255.2.gene1.p01 Protein 5e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AJ866285.2.gene1.p01 Protein 2e-128 99
KPR_2492 YP_007991471.1 hypothetical protein Y11069.1.gene1.p01 Protein 2e-116 99
KPR_2492 YP_007991471.1 hypothetical protein FJ668814.gene1.p01 Protein 4e-130 99
KPR_2492 YP_007991471.1 hypothetical protein HQ661363.1.gene1.p1 Protein 8e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AB302939.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY223863.1.gene1.p01 Protein 4e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF301532.1.gene1.p01 Protein 8e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AY079099.1.gene1.p01 Protein 6e-130 99
KPR_2492 YP_007991471.1 hypothetical protein AF535130.1.gene1.p01 Protein 1e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AF535128.1.gene1.p01 Protein 2e-129 99
KPR_2492 YP_007991471.1 hypothetical protein AM176548.2.gene1.p01 Protein 1e-127 99
KPR_2492 YP_007991471.1 hypothetical protein GU932590.1.gene1.p1 Protein 2e-126 98
KPR_2492 YP_007991471.1 hypothetical protein GU827715.1.gene1.p01 Protein 1e-127 98
KPR_2492 YP_007991471.1 hypothetical protein FJ194944.1.gene1.p01 Protein 5e-128 98
KPR_2492 YP_007991471.1 hypothetical protein AY037780.1.gene1.p01 Protein 3e-123 91
KPR_2492 YP_007991471.1 hypothetical protein JF949915.1.gene1.p01 Protein 3e-84 68
KPR_2492 YP_007991471.1 hypothetical protein JF949916.1.gene1.p01 Protein 2e-84 68
KPR_2492 YP_007991471.1 hypothetical protein AY130284.1.gene1.p1 Protein 3e-86 66
KPR_2492 YP_007991471.1 hypothetical protein AY130282.1.gene1.p1 Protein 3e-84 66
KPR_2492 YP_007991471.1 hypothetical protein AY130285.1.gene1.p1 Protein 2e-86 66
KPR_2492 YP_007991471.1 hypothetical protein AY327540.1.gene1.p01 Protein 2e-87 66
KPR_2492 YP_007991471.1 hypothetical protein Y13612.1.gene1.p01 Protein 1e-88 66
KPR_2492 YP_007991471.1 hypothetical protein FQ312006.1.gene118.p Protein 4e-93 66
KPR_2492 YP_007991471.1 hypothetical protein FJ405211.1.gene1.p01 Protein 2e-93 66
KPR_2492 YP_007991471.1 hypothetical protein NC_011586.7045197.p0 Protein 4e-93 66
KPR_2492 YP_007991471.1 hypothetical protein FJ919776.1.gene1.p01 Protein 1e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AF516720.1.gene1.p1 Protein 5e-93 66
KPR_2492 YP_007991471.1 hypothetical protein Y17581.1.gene1.p01 Protein 5e-89 66
KPR_2492 YP_007991471.1 hypothetical protein AY368236.1.gene1.p1 Protein 3e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AM087454.1.gene1.p01 Protein 9e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AY027590.1.gene1.p1 Protein 1e-88 66
KPR_2492 YP_007991471.1 hypothetical protein AJ634602.gene.p01 Protein 2e-89 66
KPR_2492 YP_007991471.1 hypothetical protein U95363.2.gene1.p01 Protein 1e-88 66
KPR_2492 YP_007991471.1 hypothetical protein HQ451074.1.gene4.p01 Protein 4e-93 66
KPR_2492 YP_007991471.1 hypothetical protein Y14574.2.gene1.p01 Protein 1e-92 66
KPR_2492 YP_007991471.1 hypothetical protein GU550123.1.gene1.p1 Protein 2e-93 66
KPR_2492 YP_007991471.1 hypothetical protein NC_010558.1.6276043. Protein 4e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AF188199.1.gene1.p01 Protein 1e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AM183304.1.gene1.p01 Protein 5e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AY101578.1.gene1.p01 Protein 5e-89 66
KPR_2492 YP_007991471.1 hypothetical protein DQ279850.1.gene1.p1 Protein 4e-93 66
KPR_2492 YP_007991471.1 hypothetical protein FJ197316.1.gene1.p1 Protein 4e-94 66
KPR_2492 YP_007991471.1 hypothetical protein AY628199.1.gene1.p01 Protein 3e-89 66
KPR_2492 YP_007991471.1 hypothetical protein AY589493.1.gene1.p01 Protein 3e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AM941159.1.gene1.p01 Protein 2e-93 66
KPR_2492 YP_007991471.1 hypothetical protein AF506748.1.gene1.p1 Protein 3e-92 66
KPR_2492 YP_007991471.1 hypothetical protein AF397068.1.gene1.p1 Protein 1e-91 66
KPR_2492 YP_007991471.1 hypothetical protein AY327539.1.gene1.p01 Protein 6e-91 65
KPR_2492 YP_007991471.1 hypothetical protein FJ807656.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AJ866988.1.gene1.p01 Protein 6e-92 65
KPR_2492 YP_007991471.1 hypothetical protein EU815939.1.gene1.p1 Protein 2e-91 65
KPR_2492 YP_007991471.1 hypothetical protein AF351241.1.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein Y17582.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AM849805.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein JN211012.1.gene1.p01 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY826417.1.gene1.p01 Protein 8e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF157553.1.gene1.p1 Protein 3e-88 65
KPR_2492 YP_007991471.1 hypothetical protein AF190694.1.gene1.p01 Protein 6e-93 65
KPR_2492 YP_007991471.1 hypothetical protein Y10280.1.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF427128.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY628175.1.gene1.p01 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AJ318094.1.gene1.p01 Protein 8e-89 65
KPR_2492 YP_007991471.1 hypothetical protein X54606.1.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF535127.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AJ239002.1.gene1.p01 Protein 7e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY589494.1.gene1.p01 Protein 3e-88 65
KPR_2492 YP_007991471.1 hypothetical protein DQ105529.2.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein HQ529916.1.gene1.p01 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AB049569.1.gene1.p01 Protein 9e-88 65
KPR_2492 YP_007991471.1 hypothetical protein AF347054.1.gene1.p1 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein X57972.1.gene1.p1 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein EF534736.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein FJ873740.1.gene1.p01 Protein 3e-91 65
KPR_2492 YP_007991471.1 hypothetical protein AY368237.1.gene1.p1 Protein 4e-93 65
KPR_2492 YP_007991471.1 hypothetical protein AY307100.1.gene1.p1 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF104441.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF104442.1.gene1.p01 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY072920.1.gene1.p1 Protein 3e-93 65
KPR_2492 YP_007991471.1 hypothetical protein FN652295.1.gene1.p01 Protein 9e-88 65
KPR_2492 YP_007991471.1 hypothetical protein AF468003.1.gene1.p1 Protein 8e-93 65
KPR_2492 YP_007991471.1 hypothetical protein AJ308558.1.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF190695.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein Y17583.1.gene1.p01 Protein 7e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF091113.2.gene1.p01 Protein 2e-91 65
KPR_2492 YP_007991471.1 hypothetical protein AJ277414.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein EF136377.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AJ746225.1.gene1.p01 Protein 8e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF332513.1.gene1.p01 Protein 4e-88 65
KPR_2492 YP_007991471.1 hypothetical protein JN227084.1.gene1.p01 Protein 6e-93 65
KPR_2492 YP_007991471.1 hypothetical protein AF427127.1.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY491682.1.gene1.p1 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein X65254.1.gene1.p01 Protein 6e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AM049399.1.gene1.p01 Protein 1e-91 65
KPR_2492 YP_007991471.1 hypothetical protein EF136376.1.gene1.p01 Protein 1e-88 65
KPR_2492 YP_007991471.1 hypothetical protein AY092401.1.gene1.p1 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein DQ072853.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein Y10281.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF190693.1.gene1.p01 Protein 4e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AM286274.1.gene1.p01 Protein 8e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY101764.1.gene1.p01 Protein 3e-88 65
KPR_2492 YP_007991471.1 hypothetical protein DQ909059.1.gene1.p1 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein JN254627.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein DQ075245.1.gene1.p01 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY574271.1.gene1.p01 Protein 1e-91 65
KPR_2492 YP_007991471.1 hypothetical protein AF250872.1.gene1.p1 Protein 1e-87 65
KPR_2492 YP_007991471.1 hypothetical protein DQ105528.2.gene1.p01 Protein 9e-93 65
KPR_2492 YP_007991471.1 hypothetical protein AY243512.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY874537.1.gene1.p01 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF093512.1.gene1.p01 Protein 4e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY528425.1.gene1.p1 Protein 7e-92 65
KPR_2492 YP_007991471.1 hypothetical protein JN416112.1.gene1.p01 Protein 3e-91 65
KPR_2492 YP_007991471.1 hypothetical protein FJ360884.1.gene1.p01 Protein 5e-93 65
KPR_2492 YP_007991471.1 hypothetical protein GU371926.1.gene94.p0 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF203816.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein X64523.1.gene1.p01 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein DQ679961.1.gene1.p01 Protein 1e-91 65
KPR_2492 YP_007991471.1 hypothetical protein DQ369751.1.gene1.p01 Protein 9e-88 65
KPR_2492 YP_007991471.1 hypothetical protein AF516719.1.gene1.p1 Protein 8e-93 65
KPR_2492 YP_007991471.1 hypothetical protein AY956335.1.gene1.p1 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF190692.1.gene1.p01 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY628176.1.gene1.p01 Protein 7e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AJ318093.1.gene1.p01 Protein 1e-88 65
KPR_2492 YP_007991471.1 hypothetical protein AF427130.1.gene1.p01 Protein 4e-93 65
KPR_2492 YP_007991471.1 hypothetical protein Y17584.1.gene1.p01 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein EU274580.1.gene1.p1 Protein 2e-92 65
KPR_2492 YP_007991471.1 hypothetical protein U37195.1.gene1.p1 Protein 3e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AY853593.1.gene1.p1 Protein 5e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF427129.1.gene1.p01 Protein 1e-90 65
KPR_2492 YP_007991471.1 hypothetical protein AY436361.1.gene1.p01 Protein 4e-88 65
KPR_2492 YP_007991471.1 hypothetical protein Y10279.1.gene1.p01 Protein 7e-93 65
KPR_2492 YP_007991471.1 hypothetical protein DQ286729.1.gene1.p1 Protein 1e-92 65
KPR_2492 YP_007991471.1 hypothetical protein AF397067.1.gene1.p1 Protein 3e-91 65
KPR_2492 YP_007991471.1 hypothetical protein AF397066.1.gene1.p1 Protein 3e-91 65
KPR_2492 YP_007991471.1 hypothetical protein AY589495.1.gene1.p01 Protein 1e-91 64
KPR_2492 YP_007991471.1 hypothetical protein AJ277415.1.gene1.p01 Protein 2e-92 64
KPR_2492 YP_007991471.1 hypothetical protein DQ834729.1.gene1.p1 Protein 4e-92 64
KPR_2492 YP_007991471.1 hypothetical protein EF468463.1.gene1.p01 Protein 7e-92 64
KPR_2492 YP_007991471.1 hypothetical protein AF495873.1.gene1.p1 Protein 9e-92 64
KPR_2492 YP_007991471.1 hypothetical protein HM246246.1.gene1.p1 Protein 5e-92 64
KPR_2492 YP_007991471.1 hypothetical protein AY271267.1.gene1.p01 Protein 8e-91 64
KPR_2492 YP_007991471.1 hypothetical protein AY039040.1.gene1.p01 Protein 2e-88 64
KPR_2492 YP_007991471.1 hypothetical protein X65253.1.gene1.p01 Protein 3e-91 64
KPR_2492 YP_007991471.1 hypothetical protein DQ834728.1.gene1.p1 Protein 8e-92 64
KPR_2492 YP_007991471.1 hypothetical protein AY178993.1.gene1.p01 Protein 5e-60 47
KPR_2492 YP_007991471.1 hypothetical protein AF135373.1.gene1.p01 Protein 5e-60 47
KPR_2492 YP_007991471.1 hypothetical protein EU729727.1.gene1.p1 Protein 1e-41 46
KPR_2492 YP_007991471.1 hypothetical protein AF313471.1.gene2.p01 Protein 2e-52 45
KPR_2492 YP_007991471.1 hypothetical protein AY008290.1.gene1.p1 Protein 1e-52 45
KPR_2492 YP_007991471.1 hypothetical protein AF030945.1.gene1.p01 Protein 2e-51 45
KPR_2492 YP_007991471.1 hypothetical protein S46063.1.gene1.p2 Protein 1e-52 45
KPR_2492 YP_007991471.1 hypothetical protein AB126603.gene.p01 Protein 2e-52 45
KPR_2492 YP_007991471.1 hypothetical protein U14748.1.gene2.p01 Protein 1e-52 45
KPR_2492 YP_007991471.1 hypothetical protein AY123251.gene6.p01 Protein 4e-51 44
KPR_2492 YP_007991471.1 hypothetical protein AF297554.1.gene1.p1 Protein 8e-42 44
KPR_2492 YP_007991471.1 hypothetical protein AF395881.gene.p01 Protein 4e-42 42
KPR_2492 YP_007991471.1 hypothetical protein FJ234412.1.gene1.p01 Protein 2e-42 42
KPR_2492 YP_007991471.1 hypothetical protein GQ140348.1.gene1.p01 Protein 5e-42 42
KPR_2492 YP_007991471.1 hypothetical protein HM066995.1.gene1.p01 Protein 1e-41 41
KPR_2492 YP_007991471.1 hypothetical protein AY034847.1.gene1.p01 Protein 3e-42 41
KPR_2492 YP_007991471.1 hypothetical protein EU555534.1.gene1.p01 Protein 2e-42 41
KPR_2492 YP_007991471.1 hypothetical protein HQ641421.1.gene1.p01 Protein 5e-42 41