Gene Information

Name : ramA (KPR_4001)
Accession : YP_007992975.1
Strain : Klebsiella pneumoniae SB3432
Genome accession: NC_021232
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4118957 - 4119298 bp
Length : 342 bp
Strand : -
Note : highly similar to transcriptional activator RamA from Klebsiella pneumoniae (sp|Q48413)

DNA sequence :
ATGACGATTTCCGCTCAGGTGATTGATACTATCGTCGAGTGGATTGATGATAACCTGCATCAACCGCTGCGTATTGATGA
TATCGCTCGCCATGCCGGGTATTCGAAATGGCATCTGCAACGGCTGTTTTTACAGTACAAAGGGGAGAGCCTGGGGCGCT
ATATTCGCGAAAGGAAGCTGCTGCTGGCCGCCCGCGATCTGCGCGACACCGATCAGCGGGTCTACGATATCTGCCTGAAG
TATGGCTTCGATTCGCAACAGACCTTTACCCGCGTCTTCACCCGGACCTTCAATCAGCCGCCGGGCGCCTACCGCAAAGA
GAACCACAGTCGCGCCCACTGA

Protein sequence :
MTISAQVIDTIVEWIDDNLHQPLRIDDIARHAGYSKWHLQRLFLQYKGESLGRYIRERKLLLAARDLRDTDQRVYDICLK
YGFDSQQTFTRVFTRTFNQPPGAYRKENHSRAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-15 52
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 5e-14 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 5e-14 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA YP_007992975.1 hypothetical protein CP001138.1.gene612.p Protein 3e-36 92
ramA YP_007992975.1 hypothetical protein CP001138.1.gene4488. Protein 4e-16 52
ramA YP_007992975.1 hypothetical protein CP001918.1.gene327.p Protein 4e-16 51
ramA YP_007992975.1 hypothetical protein CP000647.1.gene4499. Protein 5e-16 51
ramA YP_007992975.1 hypothetical protein BAC0371 Protein 5e-15 49
ramA YP_007992975.1 hypothetical protein NC_002695.1.914293.p Protein 5e-15 49
ramA YP_007992975.1 hypothetical protein CP000034.1.gene4505. Protein 9e-15 48
ramA YP_007992975.1 hypothetical protein NC_010558.1.6276025. Protein 2e-14 48
ramA YP_007992975.1 hypothetical protein CP000647.1.gene1624. Protein 3e-15 47
ramA YP_007992975.1 hypothetical protein CP001918.1.gene2033. Protein 2e-15 46
ramA YP_007992975.1 hypothetical protein CP001138.1.gene1637. Protein 1e-15 45
ramA YP_007992975.1 hypothetical protein NC_002695.1.917339.p Protein 5e-16 44
ramA YP_007992975.1 hypothetical protein BAC0560 Protein 5e-16 44
ramA YP_007992975.1 hypothetical protein CP000034.1.gene1596. Protein 5e-16 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA YP_007992975.1 hypothetical protein VFG0585 Protein 4e-16 52
ramA YP_007992975.1 hypothetical protein VFG1038 Protein 2e-14 48