Gene Information

Name : KPR_0664 (KPR_0664)
Accession : YP_007989645.1
Strain : Klebsiella pneumoniae SB3432
Genome accession: NC_021232
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 713006 - 713833 bp
Length : 828 bp
Strand : +
Note : highly similar to C-terminal region of prophage integrase from Escherichia coli O8 strain IAI1 (tr|B7M9M5)

DNA sequence :
CTGAAAACTCGGGATCTACTCGCTCCAATAAAGGTAGTAGAGGCGAGTGGGCGGCATGAAGTAGCTTCGCGTCTCCAACA
GCGAACGACTGCAATCCTGCGTTTTGCGGTACAGAATGGTCTACTTGAATATAATCCAGCTCAAGATATGGCTGGCGCAA
TCGCTGTAGCTAAACGTGTGCATCGCCCAGCTCTGGATTTCGAACGCTTCTCCGAATTGCTCGATCGTATCGAATGCTTT
AAAGGTCGAAAGTTGACTAAATTGGCAGTAAAACTAACACTGCTGGTATTCATACGTTCAAGTGAACTGCGTTTTGCAAG
ATGGGAAGAAATCGATTTTAAAAATGCGCTTTGGACGATACCAGCAGAACGAGAACCTATGAAGGGCGTAAAGCACTCAC
ATCGTGGATCTAAGATGCGTAGCCCGCACCTCGTGCCTCTAAGCCGTCAGGCACTGGAAGTGTTAAAAGATATAAAACAA
ATCAGTGGGGATTACGAATTGGTCTTCATAGGCGATCACCAACCGGATAGGCCGATGAGTGAGAACACTGTTAACAAGGC
CCTGCGCTCAATGGGCTACGACACTAAAACGGAAGTTTGTGGACATGGTTTCCGCTCTATGGCCTGCAGTGCCTTGATCG
AGTCCGGTTTATGGTCAAAAGATGCTGTTGAACGTCAGATGAGCCATCAGGAGCGTAATAACGTTCGCGCTGCTTACATC
CATCTTGCTGAGCATCTCGATGAGCGTAGGCTAATGCTACAGTGGTGGGCTGATTATCTAGATGCTAACCGGAAAGGGAT
ATTACGGCCATACGATTTTAAAAACTGA

Protein sequence :
MKTRDLLAPIKVVEASGRHEVASRLQQRTTAILRFAVQNGLLEYNPAQDMAGAIAVAKRVHRPALDFERFSELLDRIECF
KGRKLTKLAVKLTLLVFIRSSELRFARWEEIDFKNALWTIPAEREPMKGVKHSHRGSKMRSPHLVPLSRQALEVLKDIKQ
ISGDYELVFIGDHQPDRPMSENTVNKALRSMGYDTKTEVCGHGFRSMACSALIESGLWSKDAVERQMSHQERNNVRAAYI
HLAEHLDERRLMLQWWADYLDANRKGILRPYDFKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
int ACR23160.1 P4-like integrase Not tested HPI Protein 1e-68 64
int ACR23127.1 P4-like integrase Not tested HPI Protein 1e-68 64
int ACR23165.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23149.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23135.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23122.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23162.1 P4-like integrase Not tested HPI Protein 2e-67 63
int ACR23167.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23153.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23137.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23123.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23163.1 P4-like integrase Not tested HPI Protein 2e-67 63
int ACR23158.1 P4-like integrase Not tested HPI Protein 8e-68 63
int ACR23154.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23138.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23124.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23166.1 P4-like integrase Not tested HPI Protein 2e-67 63
int ACR23159.1 P4-like integrase Not tested HPI Protein 8e-68 63
int ACR23155.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23143.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23129.1 P4-like integrase Not tested HPI Protein 9e-68 63
intB ADN38950.1 P4-like integrase Not tested HPI Protein 1e-67 63
intB ADN38949.1 P4-like integrase Not tested HPI Protein 8e-68 63
int ACR23156.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23144.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23130.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23125.1 P4-like integrase Not tested HPI Protein 4e-68 63
int ACR23157.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23146.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23131.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23161.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23147.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23132.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23151.1 P4-like integrase Not tested HPI Protein 2e-67 63
int ACR23164.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23148.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23134.1 P4-like integrase Not tested HPI Protein 9e-68 63
int ACR23126.1 P4-like integrase Not tested HPI Protein 1e-67 63
int ACR23152.1 P4-like integrase Not tested HPI Protein 2e-67 63
intB ADN38951.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38967.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38959.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38952.1 P4-like integrase Not tested HPI Protein 8e-73 62
int ACR23136.1 P4-like integrase Not tested HPI Protein 9e-73 62
intB ADN38968.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38960.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38953.1 P4-like integrase Not tested HPI Protein 8e-73 62
int ACR23139.1 P4-like integrase Not tested HPI Protein 9e-73 62
intB ADN38969.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38961.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38954.1 P4-like integrase Not tested HPI Protein 8e-73 62
int ACR23141.1 P4-like integrase Not tested HPI Protein 9e-73 62
intB ADN38962.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38955.1 P4-like integrase Not tested HPI Protein 8e-73 62
int ACR23142.1 P4-like integrase Not tested HPI Protein 9e-73 62
int ACR23133.1 P4-like integrase Not tested HPI Protein 1e-67 62
intB ADN38963.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38956.1 P4-like integrase Not tested HPI Protein 8e-73 62
int ACR23145.1 P4-like integrase Not tested HPI Protein 9e-73 62
int ACR23140.1 P4-like integrase Not tested HPI Protein 1e-67 62
int ACR23128.1 P4-like integrase Not tested HPI Protein 8e-67 62
intB ADN38964.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38947.1 P4-like integrase Not tested HPI Protein 8e-73 62
int ACR23150.1 P4-like integrase Not tested HPI Protein 1e-67 62
intB ADN38965.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38957.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38948.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38966.1 P4-like integrase Not tested HPI Protein 8e-73 62
intB ADN38958.1 P4-like integrase Not tested HPI Protein 8e-73 62
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 1e-62 61
int CAB59975.1 integrase Not tested HPI Protein 3e-68 60
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 3e-75 60