Gene Information

Name : LBFF_0015 (LBFF_0015)
Accession : YP_007994220.1
Strain : Lactobacillus fermentum F-6
Genome accession: NC_021235
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 16565 - 17272 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGGCCAAGAAAGTTTTGGTTGTTGACGATGAAAAACCGATTTCGGATATCATTAAGTTTAACCTAGAAAAGGAGGGCTA
TGAAGTCGTCGTGGCTTACGACGGGGAAGAGGCCCTGCAAAAGGTCGAAAGCGAGTCACCGGATCTGATCGTCTTAGACC
TGATGCTGCCCAAAATTGACGGCCTGGAAGTGGCTAAGCAGGTGCGGGCTAAGCGTTCGACGCCAATCATCATGGTAACG
GCTAAGGATTCGGAACTCGATAAGGTTTTGGGCCTTGAGTTGGGGGCCGACGATTACGTTACCAAGCCGTTTTCTAACCG
TGAGCTAGTGGCCCGGGTTAAGGCTAACCTGCGCCGCCAAGACGCCACCGTTTCACCGGCGAACGACGACCGGACCGCCG
ATATCAAGGTGGGGGATTTGACCATCCACCCGGACGCCTACACGGTCACCAAGCGGGGCGAAAACATCAACCTGACCCAC
CGGGAGTTCGAGCTCTTGCACTACCTCGCCCAACACATTGGCCAGGTCATCAACCGGGAGCACCTCTTGCAAACGGTGTG
GGGCTACGATTACTTTGGTGACGTCCGGACCGTTGACGTAACGGTGCGCCGGTTGCGTGAAAAAATCGAAGATAACCCGA
GTCACCCCCAGTGGCTGATCACGCGGCGGGGGGTCGGTTACTACCTGGCCAACCCGAATCAGGATTAA

Protein sequence :
MAKKVLVVDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESESPDLIVLDLMLPKIDGLEVAKQVRAKRSTPIIMVT
AKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQDATVSPANDDRTADIKVGDLTIHPDAYTVTKRGENINLTH
REFELLHYLAQHIGQVINREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPQWLITRRGVGYYLANPNQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-69 70
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-57 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-58 57
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-58 56
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-50 54
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 8e-44 50
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-45 48
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-41 47
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-38 45
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-35 44
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-38 44
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-31 44
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 5e-31 43
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 3e-35 43
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 3e-35 43
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 5e-38 43
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 3e-35 42
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 5e-38 42
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 9e-37 42
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-29 42
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family BAC0533 Protein 6e-35 41
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 6e-35 41
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 3e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 1e-30 43
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family VFG1563 Protein 4e-34 41
LBFF_0015 YP_007994220.1 Two component transcriptional regulator, winged helix family VFG1702 Protein 2e-34 41