Gene Information

Name : czcR1 (PFLCHA0_c02020)
Accession : YP_007997507.1
Strain : Pseudomonas fluorescens CHA0
Genome accession: NC_021237
Putative virulence/resistance : Virulence
Product : transcriptional activator protein CzcR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 237836 - 238516 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGCGTTTGCTGGTAGTTGAAGACGAAGCCAAGACCGCCCATTTCCTTGCCAAGGGCCTGGGAGAATCCGGCTTTGCCGT
GGACGTGGCCCTGAACGGCCTGGACGGGCGCTATTTCATCGAGCAGCAGGAGTACGACCTGATCATCCTCGACGTCATGC
TCCCCGGCCTCAACGGCTGGCAGTTGCTGCAACTGGTGCGCCAGCGCGGTGCCACCCCGGTGCTGTTCCTCACCGCCCGC
GACGCTATCGAGGATCGGGTCCGCGGCCTGGAACTGGGCGCCGACGACTACCTGCTCAAGCCCTTCGCTTTTGCCGAGCT
ACTGGCCCGGGTGCGCACCCTGCTGCGCCGCGGACCGCTGCGCGAGGCCGAGTCCTTCAGCATCGCCGACCTGGAGATCG
ACGTGCTGCGCCGTCGCGTCAGCCGTGGCGGCCAGCGCATCGCCCTGACCAACAAGGAGTTCGCCCTACTGCACCTGTTG
GCCAGCCGCCAGGGCGAAGTGCTGTCGCGGACCCTCATCGCCTCCCAGGTGTGGAACCTGAATTTCGACAGCGACACCAA
CATGGTGGAAGTGGCGGTACGAAGGTTGCGGGCCAAGGTCGACGACCCCTACATGCCCAAGCTGATCCACACCGTGCGTG
GCGTCGGCTACCAGCTGGAAGCCCCGGATGAAGCGCTCTAG

Protein sequence :
MRLLVVEDEAKTAHFLAKGLGESGFAVDVALNGLDGRYFIEQQEYDLIILDVMLPGLNGWQLLQLVRQRGATPVLFLTAR
DAIEDRVRGLELGADDYLLKPFAFAELLARVRTLLRRGPLREAESFSIADLEIDVLRRRVSRGGQRIALTNKEFALLHLL
ASRQGEVLSRTLIASQVWNLNFDSDTNMVEVAVRRLRAKVDDPYMPKLIHTVRGVGYQLEAPDEAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-57 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0125 Protein 3e-69 67
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0638 Protein 8e-60 64
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0083 Protein 3e-66 63
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0111 Protein 1e-65 62
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0197 Protein 3e-65 60
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0347 Protein 3e-59 59
czcR1 YP_007997507.1 transcriptional activator protein CzcR BAC0308 Protein 2e-61 59
czcR1 YP_007997507.1 transcriptional activator protein CzcR AE000516.2.gene3505. Protein 1e-31 45
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002952.2859905.p0 Protein 3e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002758.1121668.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_009641.5332272.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_013450.8614421.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_007793.3914279.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_003923.1003749.p0 Protein 6e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_007622.3794472.p0 Protein 3e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002745.1124361.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_009782.5559369.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002951.3237708.p0 Protein 4e-34 43
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_007793.3914065.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002758.1121390.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_010079.5776364.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002952.2859858.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_007622.3794948.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_003923.1003417.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_013450.8614146.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR NC_002951.3238224.p0 Protein 2e-37 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR HE999704.1.gene1528. Protein 1e-26 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR1 YP_007997507.1 transcriptional activator protein CzcR VFG0596 Protein 1e-57 57
czcR1 YP_007997507.1 transcriptional activator protein CzcR VFG1390 Protein 2e-38 46
czcR1 YP_007997507.1 transcriptional activator protein CzcR VFG1386 Protein 2e-33 42
czcR1 YP_007997507.1 transcriptional activator protein CzcR VFG1389 Protein 2e-33 42