Gene Information

Name : czcR5 (PFLCHA0_c51930)
Accession : YP_008002444.1
Strain : Pseudomonas fluorescens CHA0
Genome accession: NC_021237
Putative virulence/resistance : Virulence
Product : transcriptional activator protein CzcR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5800543 - 5801217 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGTATTCTGGTCATCGAAGACGAACCCAAGACCGCTGACTACCTGCATCAGGGGCTGACTGAAAGTGGCTACGTGGT
GGATTGCGCCAACAACGGCGCGGACGGCCTGCACCTGACTCGCCAGCATGCGTACGACCTGGTGATCCTCGACATCAACC
TGCCGCACATCGACGGCTGGGGCGTGCTCGGGCAGATCCGCCAGGACAGCAGCACCCGGGTGATGATGCTCACCGCCCAG
GGCCGGCTGGCGGACAAGATCCGTGGCCTGGACCTGGGCGCCGACGATTACCTGGTCAAGCCGTTCCAGTTTCCGGAATT
GCTGGCCCGGGTCCGCACCCTGATGCGCCGCAGCGAACAGGCGCCGGTGCCGGATGTGCTGCGGGTCGCCGACCTGGAGC
TGGACCAGGGCCGGCACCGGGCCTTTCGCGGCAAGCAGCGCATCGACCTGACCACCAAGGAGTTCGCCCTGCTGCACCTG
CTGATGCGCCAGAGCGGCGTGGTGCTGTCGCGGACCCAGATCATTTCCTTTGTCTGGGACATGAATTTCGACTGTGACAC
CAATGTGGTGGAAGTCTCGATCCGCCGCCTGCGGGCCAAGATCGACGACCCTTTCGAACGCAAGCTGATCCACACCCTGC
GCGGTGTGGGTTATGTCCTTGAAGAACGCGACTGA

Protein sequence :
MRILVIEDEPKTADYLHQGLTESGYVVDCANNGADGLHLTRQHAYDLVILDINLPHIDGWGVLGQIRQDSSTRVMMLTAQ
GRLADKIRGLDLGADDYLVKPFQFPELLARVRTLMRRSEQAPVPDVLRVADLELDQGRHRAFRGKQRIDLTTKEFALLHL
LMRQSGVVLSRTQIISFVWDMNFDCDTNVVEVSIRRLRAKIDDPFERKLIHTLRGVGYVLEERD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-54 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-53 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0125 Protein 1e-65 61
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0197 Protein 7e-63 58
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0083 Protein 5e-59 57
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0638 Protein 1e-55 57
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0308 Protein 2e-57 54
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0111 Protein 1e-59 52
czcR5 YP_008002444.1 transcriptional activator protein CzcR BAC0347 Protein 2e-55 51
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_013450.8614146.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_002951.3238224.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_007793.3914065.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_002758.1121390.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_010079.5776364.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_002952.2859858.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_007622.3794948.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR NC_003923.1003417.p0 Protein 5e-39 44
czcR5 YP_008002444.1 transcriptional activator protein CzcR AE015929.1.gene1106. Protein 4e-34 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR5 YP_008002444.1 transcriptional activator protein CzcR VFG0596 Protein 2e-54 52
czcR5 YP_008002444.1 transcriptional activator protein CzcR VFG1386 Protein 2e-37 43
czcR5 YP_008002444.1 transcriptional activator protein CzcR VFG1389 Protein 2e-34 42
czcR5 YP_008002444.1 transcriptional activator protein CzcR VFG1390 Protein 2e-37 41