Gene Information

Name : AORI_1657 (AORI_1657)
Accession : YP_008010648.1
Strain : Amycolatopsis orientalis HCCB10007
Genome accession: NC_021252
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1766852 - 1767529 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
GTGGCCCGCATCCTGATCGCCGAGGACGAGGAGCGCATCGCCTCGTTCGTCCGCAAGGGGCTCGTCGCCAACGGCTTCAC
CACCACCGTCGTCGCGGACGGTGAGCAGGCCCTCCAGTACGCCCTCGGTGACGGCTACGACCTGCTGGTGCTCGACCTCG
GCCTGCCCTCCCGCGACGGCCTGTCCGTGCTTCGGACGCTGCGCGAACACCACAACACCACCCCGGTGGTGATCCTCACC
GCGCACGATTCGCCGCAGACCACCCTGGCCGGGCTTGAAGGCGGCGCCGACGACTACATGGCCAAACCGTTCCGCTTCGA
CGAGCTGCTGGCCAGGATCCGGCTCCGGCTGCGCCGCACCGAACTCGTCGCCGAGACCACCGTGCTGCACGCGGGCCCGC
TGTCGCTGGATCTGCGCACGCGCCGCGCGGACGTCGACGGCACCGGCGTCGACCTGACCTCGCGCGAGTTCGCCCTGCTG
GAGCTGTTCATCCGCCACCAGGGCCAGGTGCTGACCCGCGAGCAGATCCTCTCCCACGTGTGGGGGTACGACTTCGACCC
GGGCTCCAACATCGTCGACGTCTACGTCCGCACCCTGCGCCGCAAGATCGGGGCGGGCCACATCCGCACCGCGCGCGGCA
TGGGCTACGCGTTCGACCCCGGTCGCACATCACCTTGA

Protein sequence :
MARILIAEDEERIASFVRKGLVANGFTTTVVADGEQALQYALGDGYDLLVLDLGLPSRDGLSVLRTLREHHNTTPVVILT
AHDSPQTTLAGLEGGADDYMAKPFRFDELLARIRLRLRRTELVAETTVLHAGPLSLDLRTRRADVDGTGVDLTSREFALL
ELFIRHQGQVLTREQILSHVWGYDFDPGSNIVDVYVRTLRRKIGAGHIRTARGMGYAFDPGRTSP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-32 47
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-25 45
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-32 44
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-31 43
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-25 42
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0111 Protein 3e-31 42
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-28 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-27 41
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-31 43
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-28 42
AORI_1657 YP_008010648.1 two component transcriptional regulator, winged helix family VFG0596 Protein 8e-28 41