Gene Information

Name : phoB (AORI_2202)
Accession : YP_008011193.1
Strain : Amycolatopsis orientalis HCCB10007
Genome accession: NC_021252
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2361071 - 2361760 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
GTGACGACACAACCGGGACGCGGGCTGGTGCTGGTCGTCGAGGACGACCCCGCGATCGCCGAACTCGCCTCGCTGTACCT
GCGGCGGGACGGGTTCGGCGTGCACGTGGAGGCGGACGGCGGCGCGGCACTGGCCACGATCCGGCGGATGCGCCCGGTCG
CGATCGTGCTCGACATCGGACTGTCCGGAATGGACGGTATCGAGATCTGCCGGACCCTGCGCGCGGACGGTGACTGGACG
CCCGTGCTGTTCGTGACCGCGCGCGACGACGAACTGGACCGCTTGCTGGGCTTGGAGATCGGCGCGGACGACTACCTGAC
GAAACCGTTCAGCCCGCGTGAGCTCTCGGCGAGGGTCCGGACCGTGCTGCGCCGGGCCGCCGGGGCGCCGTCGCCGGCCG
AGACCTACACCGCGGGCGGCGTCCGGGTCGACGTCACCCAGCGGCGTGTCTGGGCGGGCGGCACCGAGATCGCGCTGACG
TCGACCGAGTTCGATCTGCTGACCCATCTGGCGCGACGGCCCGGCCAGGTGTTCAGCCGCGAACAGCTGCTCAGTTCCGT
CTGGGGGTACGCGGCTTCGGCGGGCACGCGGACCGTCGATGTCCACATCGCCCAGCTGCGCGGGAAACTGGGCGAGCACA
GTCCGATCAGGACGGTCCGTGGCATCGGTTACGCGGCGGACGCCGGATGA

Protein sequence :
MTTQPGRGLVLVVEDDPAIAELASLYLRRDGFGVHVEADGGAALATIRRMRPVAIVLDIGLSGMDGIEICRTLRADGDWT
PVLFVTARDDELDRLLGLEIGADDYLTKPFSPRELSARVRTVLRRAAGAPSPAETYTAGGVRVDVTQRRVWAGGTEIALT
STEFDLLTHLARRPGQVFSREQLLSSVWGYAASAGTRTVDVHIAQLRGKLGEHSPIRTVRGIGYAADAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_008011193.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-40 46
phoB YP_008011193.1 two-component system response regulator BAC0125 Protein 1e-29 43
phoB YP_008011193.1 two-component system response regulator CP000647.1.gene2531. Protein 7e-30 43
phoB YP_008011193.1 two-component system response regulator CP000675.2.gene1535. Protein 2e-33 42
phoB YP_008011193.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_012469.1.7686381. Protein 4e-37 42
phoB YP_008011193.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-39 42
phoB YP_008011193.1 two-component system response regulator CP001138.1.gene2239. Protein 3e-31 42
phoB YP_008011193.1 two-component system response regulator CP000034.1.gene2186. Protein 5e-31 42
phoB YP_008011193.1 two-component system response regulator NC_002695.1.916589.p Protein 5e-31 42
phoB YP_008011193.1 two-component system response regulator BAC0596 Protein 3e-31 42
phoB YP_008011193.1 two-component system response regulator CP001918.1.gene3444. Protein 3e-30 42
phoB YP_008011193.1 two-component system response regulator BAC0039 Protein 5e-31 42
phoB YP_008011193.1 two-component system response regulator BAC0083 Protein 2e-27 41
phoB YP_008011193.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-36 41
phoB YP_008011193.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-34 41
phoB YP_008011193.1 two-component system response regulator CP000034.1.gene3671. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_008011193.1 two-component system response regulator VFG1389 Protein 2e-31 47
phoB YP_008011193.1 two-component system response regulator VFG1386 Protein 2e-33 42
phoB YP_008011193.1 two-component system response regulator VFG0596 Protein 2e-20 41
phoB YP_008011193.1 two-component system response regulator VFG1390 Protein 8e-30 41