Gene Information

Name : mtrA (AORI_3094)
Accession : YP_008012082.1
Strain : Amycolatopsis orientalis HCCB10007
Genome accession: NC_021252
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3370013 - 3370687 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
GTGATCGAAGACGACGCGTCCGTGCGGGAGGGGCTGGAACTCGCGCTGCGACGGCAGGCGCACACCGTGTACACCGCCGA
GAGCGGCGAGCTCGGGCTGGAGAAACTGCGGGTGTTCCAGCCCGACATCGTCGTACTGGACCTGATGCTCCCCGGCATCG
ACGGCTTCGAGACCTGCCGCCGCATCCGCTCGGCGGGCGAGGTGCCGATCATCATGCTCACCGCCCGCAGCGACGACTTC
GACATCGTGGCCGGCTTGGAGGCGGGCGCCGACGACTACGTCACCAAGCCGATCGAGCCGCGGGTGCTCGACGCCCGGAT
CCGGGCGGTGCTGCGCCGCGCGGTGAGCGAGAAGCCCGCGAGCGACGACGCCGCCGGGGAACGGCACGGCGGCCTGGTCA
TCGACCGGGCCGGGCTGGTCGTCACGAAGAACGGCGAGCCGGTCTCGCTCACCCCGACCGAGCTGAAGCTGCTGCTGGAG
CTGTCGCGCACGCCGGGCCAGGTCTACAGCCGCCAGCAGATCCTCTCCGCCGTCTGGGATCACGACTACCTCGGCGACTC
CCGGCTGGTCGACGCCTGTGTCCAGCGGTTGCGCGCGAAGATCGAAGACGTGCCCGCGAAACCCGAACACGTCCAGACCG
TCCGCGGCTTCGGGTACCGGTTCGGCCGTTCATGA

Protein sequence :
MIEDDASVREGLELALRRQAHTVYTAESGELGLEKLRVFQPDIVVLDLMLPGIDGFETCRRIRSAGEVPIIMLTARSDDF
DIVAGLEAGADDYVTKPIEPRVLDARIRAVLRRAVSEKPASDDAAGERHGGLVIDRAGLVVTKNGEPVSLTPTELKLLLE
LSRTPGQVYSRQQILSAVWDHDYLGDSRLVDACVQRLRAKIEDVPAKPEHVQTVRGFGYRFGRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008012082.1 two-component system response regulator NC_012469.1.7685629. Protein 7e-39 44
mtrA YP_008012082.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-33 43
mtrA YP_008012082.1 two-component system response regulator BAC0197 Protein 1e-21 43
mtrA YP_008012082.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-34 42
mtrA YP_008012082.1 two-component system response regulator NC_002951.3237708.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_003923.1003749.p0 Protein 8e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_002758.1121668.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_009641.5332272.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_013450.8614421.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_007793.3914279.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-34 42
mtrA YP_008012082.1 two-component system response regulator NC_002745.1124361.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_009782.5559369.p0 Protein 9e-35 42
mtrA YP_008012082.1 two-component system response regulator NC_002758.1121390.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_010079.5776364.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_002952.2859858.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_007622.3794948.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_003923.1003417.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_013450.8614146.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_002951.3238224.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator NC_007793.3914065.p0 Protein 7e-28 41
mtrA YP_008012082.1 two-component system response regulator AE015929.1.gene1106. Protein 7e-25 41
mtrA YP_008012082.1 two-component system response regulator NC_010410.6002989.p0 Protein 1e-23 41
mtrA YP_008012082.1 two-component system response regulator NC_010400.5986590.p0 Protein 1e-23 41
mtrA YP_008012082.1 two-component system response regulator NC_011595.7057856.p0 Protein 1e-23 41
mtrA YP_008012082.1 two-component system response regulator BAC0083 Protein 5e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008012082.1 two-component system response regulator VFG0596 Protein 2e-19 42