Gene Information

Name : mtrA (AORI_6805)
Accession : YP_008015790.1
Strain : Amycolatopsis orientalis HCCB10007
Genome accession: NC_021252
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, response regulator MtrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7611424 - 7612101 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGAAGGCACGTGTTCTGGTCGTCGACGACGACCCTGCTCTCGCGGAGATGCTCACCATCGTGCTGCGTGGGGAGGGGTT
CGACACAGCCGTCGTGGCCGACGGCTCACGGGCGCTGCCCGCGCTTCGTGAGCTGAAACCGGACCTGGTCCTCCTCGACC
TCATGCTGCCCGGCATGAACGGCATCGACGTCTGCAAGGCGATCCGGGCCGAATCCGGCGTGCCGATCGTGATGCTCACC
GCCAAGAGCGACACCGTGGACATCGTCCTCGGGCTCGAGTCGGGGGCCGACGACTACGTGGTCAAGCCCTTCAAACCGAA
GGAGCTCGTGGCCCGCGTCCGCGCCAGGATGCGCCGCACCGAGGCCGAGCCCGCCGAGTCGCTGACGATCGGCGACCTCG
CGATCGACGTCCCCGGCCACGAGGTGACGCGGGAGGGCAAGGCCATCCCGCTGACCCCGCTCGAGTTCGACCTCCTGGTC
GCGCTCGCCCGCAAGCCGCGTCAGGTGTTCACCCGCGAGGTGCTCCTCGAGCAGGTGTGGGGCTACCGCCACGCCGCCGA
CACCCGGCTGGTGAACGTGCACGTCCAGCGGCTGCGGTCGAAGGTGGAGAAGGACCCGGAGCACCCCGAGGTGGTGTTGA
CCGTCCGCGGCGTCGGGTACAAGGCCGGCCCGCCGTGA

Protein sequence :
MKARVLVVDDDPALAEMLTIVLRGEGFDTAVVADGSRALPALRELKPDLVLLDLMLPGMNGIDVCKAIRAESGVPIVMLT
AKSDTVDIVLGLESGADDYVVKPFKPKELVARVRARMRRTEAEPAESLTIGDLAIDVPGHEVTREGKAIPLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPEHPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA AE000516.2.gene3505. Protein 1e-77 83
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002952.2859905.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002951.3237708.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_003923.1003749.p0 Protein 6e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002758.1121668.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_009641.5332272.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_013450.8614421.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_007793.3914279.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_007622.3794472.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002745.1124361.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_009782.5559369.p0 Protein 7e-43 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_012469.1.7686381. Protein 9e-43 45
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA BAC0125 Protein 9e-34 45
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA HE999704.1.gene2815. Protein 2e-39 45
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_012469.1.7685629. Protein 1e-38 44
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA AE016830.1.gene1681. Protein 9e-41 42
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA BAC0197 Protein 3e-30 42
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_013450.8614146.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002951.3238224.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA AE015929.1.gene1106. Protein 5e-31 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_007793.3914065.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002758.1121390.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_010079.5776364.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002952.2859858.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_007622.3794948.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_003923.1003417.p0 Protein 2e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA BAC0111 Protein 2e-28 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP000675.2.gene1535. Protein 1e-33 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA HE999704.1.gene1528. Protein 3e-31 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP000647.1.gene4257. Protein 8e-26 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP001138.1.gene4273. Protein 3e-26 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA BAC0533 Protein 8e-26 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP000647.1.gene2531. Protein 1e-34 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP001138.1.gene2239. Protein 6e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP000034.1.gene2186. Protein 5e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA NC_002695.1.916589.p Protein 2e-34 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA CP001918.1.gene3444. Protein 1e-34 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA BAC0596 Protein 6e-35 41
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA BAC0039 Protein 5e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA VFG1389 Protein 9e-31 46
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA VFG1702 Protein 1e-36 43
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA VFG1390 Protein 4e-33 42
mtrA YP_008015790.1 two-component system, OmpR family, response regulator MtrA VFG1563 Protein 2e-36 42