Gene Information

Name : NH44784_033551 (NH44784_033551)
Accession : YP_008030437.1
Strain : Achromobacter xylosoxidans NH44784-1996
Genome accession: NC_021285
Putative virulence/resistance : Resistance
Product : Two-component system response regulator QseB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3591356 - 3592018 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATACTTGTCGTCGAAGACGAACCGACCCTGGCCGCGCAGCTGGCCGAGGCCCTGCGACTTGCGGGTTATACCGT
CGACACCGCCGCGGACGGCGCCGACGCGCACTACATGGGCGAGGTCGAGACCTACGACGTGGTGGTGCTGGACCTGGGCC
TGCCGGTGATGGACGGCCTGACGGTGCTCAAGCAATGGCGCGCGGCCGGCCGCGGCATGCCGGTCCTGATCCTGACCGCG
CGCTCCAACTGGCACGAAAAGGTCGCCGGCATCGACGCCGGCGCCGACGACTACCTCACCAAGCCCTTCCACATGGAAGA
ACTGCTGGCGCGCGTGCGCGCCTTGCTGCGGCGGTACAGCAACCACGCCAGCGCGCAATGGCGCTGCGGGCCGCTGATGC
TCGACACGCGGCTGGCCCGCGCCACTGTCGACGGCCAGCCGCTGAACCTCACCAGCCACGAATTCAAGGTGCTGGCGGTG
CTGATGCAGCACGCCGGCGAGGTGGTATCGCGCGGTGACCTGATCGAACACATCTACGCCCAGGACCACGACCGCGACTC
CAACACCATCGACGTGTTCATCGGTCGCCTGCGCAAGAAGCTGCCGGCCGACACCATCGAGACCGTGCGCGGGCTGGGTT
ACCGGCTCGCCTGTCCGTCATGA

Protein sequence :
MRILVVEDEPTLAAQLAEALRLAGYTVDTAADGADAHYMGEVETYDVVVLDLGLPVMDGLTVLKQWRAAGRGMPVLILTA
RSNWHEKVAGIDAGADDYLTKPFHMEELLARVRALLRRYSNHASAQWRCGPLMLDTRLARATVDGQPLNLTSHEFKVLAV
LMQHAGEVVSRGDLIEHIYAQDHDRDSNTIDVFIGRLRKKLPADTIETVRGLGYRLACPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-23 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB NC_002516.2.879194.p Protein 1e-38 47
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB CP000647.1.gene1136. Protein 3e-34 46
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB BAC0530 Protein 2e-34 46
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB CP004022.1.gene1005. Protein 1e-34 44
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB BAC0125 Protein 2e-26 44
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB CP001918.1.gene2526. Protein 3e-33 44
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB BAC0487 Protein 4e-28 43
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB CP001138.1.gene1939. Protein 3e-34 43
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB BAC0083 Protein 2e-25 42
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB NC_002695.1.913289.p Protein 1e-32 42
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB CP000034.1.gene2022. Protein 7e-34 42
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB BAC0197 Protein 6e-24 42
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB U35369.1.gene1.p01 Protein 6e-24 41
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB AE016830.1.gene2255. Protein 6e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB VFG1389 Protein 2e-26 45
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB VFG0473 Protein 2e-28 44
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB VFG1390 Protein 1e-25 43
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB VFG0475 Protein 2e-34 43
NH44784_033551 YP_008030437.1 Two-component system response regulator QseB VFG0596 Protein 2e-22 41