Gene Information

Name : C629_04550 (C629_04550)
Accession : YP_008068650.1
Strain : Corynebacterium glutamicum SCgG2
Genome accession: NC_021352
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 968073 - 968753 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGTCACAGAAAATTCTCGTCGTTGATGATGATCCCGCCATCTCCGAGATGCTCACCATCGTGCTCAGCGCAGAAGGCTT
TGACACCGTAGCTGTCACCGACGGCGCACTCGCCGTGGAAACCGCCGCCCGGGAACAACCGGATCTGATTTTGCTCGACT
TGATGCTTCCAGGCATGAACGGCATCGACATTTGTCGCCTCATCCGCCAAGAATCCTCCGTACCCATCATCATGCTCACC
GCCAAAACCGACACCGTTGATGTGGTGCTCGGTTTGGAATCCGGTGCAGACGATTACGTGAACAAGCCTTTCAAAGCGAA
AGAACTTGTCGCCCGCATCCGTGCCCGCCTCCGCGCAACCGTGGACGAGCCCAGCGAAATCCTCGAAGTCGGCGATCTGT
CCATCGACGTCCCAGCACACACCGTCAAACGAAACGGCGCTGAGATTTCCTTGACCCCGCTCGAATTCGACCTCCTGCTG
GAACTCGCCCGCAAACCACAGCAAGTATTCACCCGTGAGGAATTGCTGGGCAAAGTGTGGGGCTACCGCCACGCATCCGA
CACTCGACTGGTCAACGTTCACGTTCAGCGTCTGCGCGCCAAGATTGAAAAAGATCCAGAAAATCCGCAGATCGTCCTCA
CCGTCCGCGGTGTTGGCTACAAAACTGGCCACAGCGATTAA

Protein sequence :
MSQKILVVDDDPAISEMLTIVLSAEGFDTVAVTDGALAVETAAREQPDLILLDLMLPGMNGIDICRLIRQESSVPIIMLT
AKTDTVDVVLGLESGADDYVNKPFKAKELVARIRARLRATVDEPSEILEVGDLSIDVPAHTVKRNGAEISLTPLEFDLLL
ELARKPQQVFTREELLGKVWGYRHASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKTGHSD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-37 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C629_04550 YP_008068650.1 hypothetical protein AE000516.2.gene3505. Protein 5e-69 72
C629_04550 YP_008068650.1 hypothetical protein NC_012469.1.7685629. Protein 2e-42 47
C629_04550 YP_008068650.1 hypothetical protein NC_003923.1003417.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_013450.8614146.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_002951.3238224.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_007793.3914065.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_002758.1121390.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_010079.5776364.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_002952.2859858.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_007622.3794948.p0 Protein 4e-37 46
C629_04550 YP_008068650.1 hypothetical protein NC_002952.2859905.p0 Protein 6e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_002951.3237708.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_007622.3794472.p0 Protein 6e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_002758.1121668.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_003923.1003749.p0 Protein 5e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_009641.5332272.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_013450.8614421.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_007793.3914279.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_002745.1124361.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein NC_009782.5559369.p0 Protein 7e-43 46
C629_04550 YP_008068650.1 hypothetical protein HE999704.1.gene2815. Protein 6e-40 46
C629_04550 YP_008068650.1 hypothetical protein NC_012469.1.7686381. Protein 1e-38 45
C629_04550 YP_008068650.1 hypothetical protein BAC0111 Protein 2e-27 43
C629_04550 YP_008068650.1 hypothetical protein AE016830.1.gene1681. Protein 2e-38 43
C629_04550 YP_008068650.1 hypothetical protein AE015929.1.gene1106. Protein 1e-31 42
C629_04550 YP_008068650.1 hypothetical protein AF155139.2.orf0.gene Protein 3e-34 42
C629_04550 YP_008068650.1 hypothetical protein BAC0125 Protein 1e-30 42
C629_04550 YP_008068650.1 hypothetical protein CP001918.1.gene5135. Protein 1e-17 42
C629_04550 YP_008068650.1 hypothetical protein CP000675.2.gene1535. Protein 7e-33 41
C629_04550 YP_008068650.1 hypothetical protein BAC0347 Protein 2e-23 41
C629_04550 YP_008068650.1 hypothetical protein CP001138.1.gene4273. Protein 4e-22 41
C629_04550 YP_008068650.1 hypothetical protein CP004022.1.gene3215. Protein 2e-25 41
C629_04550 YP_008068650.1 hypothetical protein BAC0197 Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C629_04550 YP_008068650.1 hypothetical protein VFG1702 Protein 3e-37 44
C629_04550 YP_008068650.1 hypothetical protein VFG1563 Protein 7e-37 43
C629_04550 YP_008068650.1 hypothetical protein VFG1389 Protein 2e-27 42
C629_04550 YP_008068650.1 hypothetical protein VFG1390 Protein 6e-31 41