Gene Information

Name : yceE (BaLi_c03730)
Accession : YP_008076524.1
Strain : Bacillus licheniformis 9945A
Genome accession: NC_021362
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein YceE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 352915 - 353493 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGCGATTCAATTATCTAAAGGGCAAAGGATCGATTTAACGAAAACGAACCCCGGTTTGACGAAAGCGCTGATCGGTTT
AGGCTGGGATACAAACAAATATACTGGCGGCGCCGATTTTGATTTGGATGCGTCGGCTTTTCTTGTCGATCAGAACGATC
GTTGCATCAATGAACGCGACTTCGTCTTTTACAACAACCTCGAGCATCCGAGCGGCGCCGTGATTCATACGGGTGACAAC
CGGACAGGAGAAGGTGAAGGCGATGACGAGCAAATCATCGTCGATTTCTCAAAAATACCCGACCATGTTGAAAAGATCGG
CATCACGGTGACGATTCACGAGGCGGAAAGCCGCAGCCAAAACTTTGGACAAGTCTCAAATGCGTTTGTCCGGCTCGTTG
ATGAATCAACAAATGAGGAGCTGCTTCGCTTTGACTTGGGAGAGGATTTTTCGATTGAGACAGCGGTTGTTGTTTGCGAA
TTGTACCGTCACGGAGCCGATTGGAAATTCAATGCGATCGGCAGCGGATTTTCCGGCGGATTGGCATCGCTTTGCCGCAA
CTACGGCCTGCAAGTCTAG

Protein sequence :
MAIQLSKGQRIDLTKTNPGLTKALIGLGWDTNKYTGGADFDLDASAFLVDQNDRCINERDFVFYNNLEHPSGAVIHTGDN
RTGEGEGDDEQIIVDFSKIPDHVEKIGITVTIHEAESRSQNFGQVSNAFVRLVDESTNEELLRFDLGEDFSIETAVVVCE
LYRHGADWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-54 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 53
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-51 52
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-47 50
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 50
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 50
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-45 48
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_008076524.1 putative stress adaptation protein YceE BAC0390 Protein 4e-52 56
yceE YP_008076524.1 putative stress adaptation protein YceE BAC0389 Protein 2e-51 53