Gene Information

Name : yclJ1 (BaLi_c04800)
Accession : YP_008076627.1
Strain : Bacillus licheniformis 9945A
Genome accession: NC_021362
Putative virulence/resistance : Virulence
Product : two-component response regulator YclJ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 478295 - 478981 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATATTAATGATTGAGGATAATTTAAGCGTATGTACAATGACAGAAATGTTTTTTGCAAAAGAAGGATTTGAAAC
AGAGTTCGTCCATGACGGACTTGAAGGATATAACCGTTTTAAATCGGATGATTGGGATTTGTTGATCATCGATATCATGC
TGCCGTCCATGGACGGGGTCACGATCTGCAAAAAGGTCAGGGAAGAGAGCACGGTTCCGATTATTATGCTGACGGCAAAA
GATACGGAATCAGACCAGGTGCTCGGTTTTGAGCTCGGAGCTGATGATTATGTGACAAAGCCGTTCAGCCCTTTGGCGCT
TGTGGCGAGAATCAAAGCGGTGAGCCGGAGGTATCAAAGTGCCGGCCCGCAGGATTCCGCTGACAGCGACTCGCTTGAAA
CGGAACATTTTAAAATCAATAAAAAAACGAGAGAAGTGTTTTTGGACGGCGTTCAAATTCAAAATTTGACGCCTAAGGAG
TTCGATTTATTGTATTACCTGGTGCAAAGTCCAAAACAGGTTTTCTCAAGGGAGCAGCTGCTTGAGCAGGTTTGGGGATA
TCAATTCTACGGAGACGAGCGGACGGTTGATGTTCATATTAAAAGGCTGAGAAAAAAGCTTGGCAGCGACTCGCGGCCGT
TTCTTTATACCGTATGGGGAGTAGGGTACAAGTTCGATGAAGATTAA

Protein sequence :
MKILMIEDNLSVCTMTEMFFAKEGFETEFVHDGLEGYNRFKSDDWDLLIIDIMLPSMDGVTICKKVREESTVPIIMLTAK
DTESDQVLGFELGADDYVTKPFSPLALVARIKAVSRRYQSAGPQDSADSDSLETEHFKINKKTREVFLDGVQIQNLTPKE
FDLLYYLVQSPKQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLGSDSRPFLYTVWGVGYKFDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-32 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ1 YP_008076627.1 two-component response regulator YclJ FJ349556.1.orf0.gene Protein 4e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_009782.5559369.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_002951.3237708.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_003923.1003749.p0 Protein 6e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_002758.1121668.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_009641.5332272.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_013450.8614421.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_007793.3914279.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_002745.1124361.p0 Protein 7e-38 44
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_002952.2859905.p0 Protein 1e-37 43
yclJ1 YP_008076627.1 two-component response regulator YclJ HE999704.1.gene2815. Protein 7e-40 43
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_007622.3794472.p0 Protein 1e-37 43
yclJ1 YP_008076627.1 two-component response regulator YclJ CP001918.1.gene5135. Protein 3e-26 43
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_012469.1.7685629. Protein 8e-38 42
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_012469.1.7686381. Protein 7e-37 41
yclJ1 YP_008076627.1 two-component response regulator YclJ AF155139.2.orf0.gene Protein 4e-37 41
yclJ1 YP_008076627.1 two-component response regulator YclJ AE016830.1.gene1681. Protein 2e-36 41
yclJ1 YP_008076627.1 two-component response regulator YclJ NC_002695.1.915041.p Protein 1e-28 41
yclJ1 YP_008076627.1 two-component response regulator YclJ CP000034.1.gene3834. Protein 1e-28 41
yclJ1 YP_008076627.1 two-component response regulator YclJ CP001138.1.gene4273. Protein 6e-29 41
yclJ1 YP_008076627.1 two-component response regulator YclJ AE000516.2.gene3505. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ1 YP_008076627.1 two-component response regulator YclJ VFG1563 Protein 4e-32 41
yclJ1 YP_008076627.1 two-component response regulator YclJ VFG1702 Protein 6e-32 41