Name : ureB (L483_12135) Accession : YP_008094213.1 Strain : Pseudomonas putida H8234 Genome accession: NC_021491 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : - COG ID : - EC number : 3.5.1.5 Position : 2611816 - 2612133 bp Length : 318 bp Strand : + Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym DNA sequence : ATGATCCCAGGTGAAATCCAGGTCGCCGCTGGCGACATCGAACTGAACAGCGGCCGGGAAACGGTCAGTGTCAGTGTGGC CAACCACGGCGACCGGCCGGTGCAGGTCGGCTCGCACTACCACTTCTACGAAGTCAACGAGGCGCTGGTGTTCGATCGTG CGCCAACCTTGGGCTTTCGCCTGGATATCCCGGCCGGCACCGCCGTGCGCTTCGAGCCTGGCCAGGCGCGCACTGTGCAA CTGGTGGCCTACGCCGGCAAGCGTGAAGTCTATGGCTTCCAGGGCAAGGTGATGGGCCCGCTGGAGGGCAGGGTATGA Protein sequence : MIPGEIQVAAGDIELNSGRETVSVSVANHGDRPVQVGSHYHFYEVNEALVFDRAPTLGFRLDIPAGTAVRFEPGQARTVQ LVAYAGKREVYGFQGKVMGPLEGRV |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 6e-27 | 67 |
ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 6e-27 | 67 |
ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 3e-26 | 61 |
ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 6e-26 | 61 |
ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 3e-26 | 61 |
ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 3e-26 | 61 |