Gene Information

Name : L483_26250 (L483_26250)
Accession : YP_008096996.1
Strain : Pseudomonas putida H8234
Genome accession: NC_021491
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5556373 - 5557047 bp
Length : 675 bp
Strand : +
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGCGCCTACTGATCATCGAGGACGAGCTGCGTACCGCCGATTACCTGCAACAAGGCCTGCGTGAAAACGGCTACGTGGT
CGACTGCGCCCACACCGGCACCGACGGCCTGCACCTGGCCCGCCAACAGCCCTATGACCTGGTCATCCTCGATGTCAACC
TGCCTGAAATCGATGGCTGGACCGTGCTGCAGCGGCTGCGAGCCGAATCGGCCACGCGCATCATGATGCTTACCGCCCAC
GGTCGCCTGGCCGACCGGGTCAAAGGCCTGGACCTGGGCGCCGACGACTACCTGCTCAAGCCGTTCGAATTCCCTGAACT
TCTGGCGCGCATCCGCAGCCTGCTGCGGCGTAACGACCAGCAACTGCAGCCCAGCACCCTGCGCGTCGCCGACCTGGAAC
TGGACCCTGGCCGGCACCGCGCCTACCGCGCCGGGCAACGCATCGACCTGACCGCCAAGGAGTTCGCCCTGCTGCACCTG
CTGATGCGCCAGACTGGCGAAGTGCTTTCGCGCACTCAGATCATCTCCTTGGTATGGGACATGAATTTCGACTGCGACAC
CAACGTGGTCGAGGTTTCGATCCGCCGCCTGCGGGCGAAGATCGACGACCCGTTCGACAACAAGCTCATCCATACCCTGC
GCGGCGTAGGCTATGTCCTTGAGGCCCGCGTTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQPYDLVILDVNLPEIDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQTGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-55 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L483_26250 YP_008096996.1 transcriptional regulator BAC0125 Protein 9e-66 60
L483_26250 YP_008096996.1 transcriptional regulator BAC0083 Protein 1e-61 59
L483_26250 YP_008096996.1 transcriptional regulator BAC0197 Protein 4e-64 59
L483_26250 YP_008096996.1 transcriptional regulator BAC0638 Protein 2e-55 59
L483_26250 YP_008096996.1 transcriptional regulator BAC0308 Protein 2e-57 55
L483_26250 YP_008096996.1 transcriptional regulator BAC0111 Protein 1e-61 55
L483_26250 YP_008096996.1 transcriptional regulator BAC0347 Protein 8e-58 51
L483_26250 YP_008096996.1 transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 44
L483_26250 YP_008096996.1 transcriptional regulator AE015929.1.gene1106. Protein 7e-33 42
L483_26250 YP_008096996.1 transcriptional regulator U82965.2.orf14.gene. Protein 2e-33 42
L483_26250 YP_008096996.1 transcriptional regulator AE000516.2.gene3505. Protein 9e-29 42
L483_26250 YP_008096996.1 transcriptional regulator CP001918.1.gene5135. Protein 4e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L483_26250 YP_008096996.1 transcriptional regulator VFG0596 Protein 4e-56 52
L483_26250 YP_008096996.1 transcriptional regulator VFG1389 Protein 3e-36 44
L483_26250 YP_008096996.1 transcriptional regulator VFG1386 Protein 3e-38 43
L483_26250 YP_008096996.1 transcriptional regulator VFG1390 Protein 6e-38 42
L483_26250 YP_008096996.1 transcriptional regulator VFG0473 Protein 7e-31 41