Gene Information

Name : PCA10_41140 (PCA10_41140)
Accession : YP_008104451.1
Strain : Pseudomonas resinovorans NBRC 106553
Genome accession: NC_021499
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4524256 - 4524918 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
ATGCGCCTGCTCCTCGTTGAAGACGACAATGCCCTGGGGGCCGGCGTACGCGCCGGCCTGCGCCAGGAGGGCTACACCAT
CGACTGGCTGACCGATGGCGCCAGCGCCCTGCATGCCTTGCAGAACGAAACCTTCGACCTGGCCATCCTCGACCTCGGCC
TGCCGCGCCTGGACGGGGTCCAGGTGTTGCAGCGGCTGCGCGCCGGCGGCGCCACCCTGCCGGTGCTGGTACTCACCGCC
CGCGACGCCCTCGAAGACCGCATCATCGGCCTGGACGCCGGCGCCGACGACTATCTGGTCAAGCCCTTCGACCTCACCGA
GCTCAAGGCCCGCCTGCGCGCCCTGCTGCGCCGCAGCGCTGGCCGAGCCCAGATGCTGATCGAGCACGCCGGGGTGGTGC
TCGACCCGGCCAGCCAGCAGGTCAGCTACCAGGGCCAACCGGTGCCACTGACTCCCAAGGAATACCAGCTGCTCCACGAA
CTGCTCTCCCAGCCAGGCAAGGTACTCACCCGCGAACGCCTGGTGCAGACGCTCTACGGCTGGGACGAGGAAGCCGAGAG
CAACACCCTCGAAGTGCATATCCACCACCTGCGCAAGAAGCTCTCCAGCGACCTCATCCGCACCGTGCGGGGCATTGGCT
ACCTGGTGGATGCTCGCCCATGA

Protein sequence :
MRLLLVEDDNALGAGVRAGLRQEGYTIDWLTDGASALHALQNETFDLAILDLGLPRLDGVQVLQRLRAGGATLPVLVLTA
RDALEDRIIGLDAGADDYLVKPFDLTELKARLRALLRRSAGRAQMLIEHAGVVLDPASQQVSYQGQPVPLTPKEYQLLHE
LLSQPGKVLTRERLVQTLYGWDEEAESNTLEVHIHHLRKKLSSDLIRTVRGIGYLVDARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-35 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-30 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-29 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCA10_41140 YP_008104451.1 putative two-component response regulator BAC0487 Protein 7e-36 49
PCA10_41140 YP_008104451.1 putative two-component response regulator NC_002516.2.879194.p Protein 3e-30 44
PCA10_41140 YP_008104451.1 putative two-component response regulator BAC0308 Protein 3e-29 43
PCA10_41140 YP_008104451.1 putative two-component response regulator BAC0197 Protein 2e-32 43
PCA10_41140 YP_008104451.1 putative two-component response regulator CP000647.1.gene1136. Protein 1e-24 41
PCA10_41140 YP_008104451.1 putative two-component response regulator Y16952.3.orf35.gene. Protein 1e-28 41
PCA10_41140 YP_008104451.1 putative two-component response regulator BAC0288 Protein 2e-28 41
PCA10_41140 YP_008104451.1 putative two-component response regulator BAC0638 Protein 2e-26 41
PCA10_41140 YP_008104451.1 putative two-component response regulator BAC0530 Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCA10_41140 YP_008104451.1 putative two-component response regulator VFG0473 Protein 2e-39 49
PCA10_41140 YP_008104451.1 putative two-component response regulator VFG0596 Protein 3e-30 45
PCA10_41140 YP_008104451.1 putative two-component response regulator VFG1390 Protein 1e-34 41