Gene Information

Name : H650_23900 (H650_23900)
Accession : YP_008110505.1
Strain : Enterobacter sp. R4-368
Genome accession: NC_021500
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4862662 - 4863057 bp
Length : 396 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGCTTTTTAATAAGCGGCGTGAGGGCAACAAGATGAACACTGGCGCATTTATTCACGATTTACTCGACTGGATCGACAA
CAACCTGGAAAGCCGTCTGGACATTGAGACCGTCTCCAGGCGGGCAGGCTATTCGAAATGGCACCTCCAGCGGCTCTTCA
AAGAGCATACGGGTTATCGTCTCGCCGAGTATATCCGCGCGCAAAAGCTGCAAAAATCGGTCGAGCGCTTAACCCACAGC
GACGAGCCGATTGTGAACGTGGCGATCGCGCTAGGCTTTGACTCCCAGCAATCCTTTAACCGCAGCTTCAAGCGTCAATA
TGGGCAGGCCCCCGGTGCATGGCGTCGCAGTGTCGGGTGCCCGCAGGCACAGCAATCACGCCAGCAATCCACATAG

Protein sequence :
MLFNKRREGNKMNTGAFIHDLLDWIDNNLESRLDIETVSRRAGYSKWHLQRLFKEHTGYRLAEYIRAQKLQKSVERLTHS
DEPIVNVAIALGFDSQQSFNRSFKRQYGQAPGAWRRSVGCPQAQQSRQQST

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-18 43
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-18 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_23900 YP_008110505.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 8e-23 52
H650_23900 YP_008110505.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 7e-23 50
H650_23900 YP_008110505.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 9e-23 50
H650_23900 YP_008110505.1 AraC family transcriptional regulator BAC0560 Protein 7e-23 49
H650_23900 YP_008110505.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 7e-23 49
H650_23900 YP_008110505.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 6e-23 49
H650_23900 YP_008110505.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 2e-18 43
H650_23900 YP_008110505.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 1e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_23900 YP_008110505.1 AraC family transcriptional regulator VFG1038 Protein 2e-18 43