Gene Information

Name : H650_03430 (H650_03430)
Accession : YP_008106536.1
Strain : Enterobacter sp. R4-368
Genome accession: NC_021500
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 599540 - 599920 bp
Length : 381 bp
Strand : +
Note : transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype; also activates sodA, zwf and micF; Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGTCCAGACGCAATACTGACGCTATCACTATTCATAGCATTTTGGACTGGATCGAGGACAACCTGGAATCGCCGCTGTC
GCTGGAAAAAGTGTCAGAGCGTTCAGGTTACTCCAAGTGGCACCTGCAACGGATGTTTAAAAAAGAGACTGGTCATTCGC
TGGGCCAGTACATTCGCAGCCGCAAGCTGACGGAAATTGCGCAAAAGCTCAAGGGAAGTAATGAGCCGATCCTGTATCTG
GCAGAGCGTTACGGGTTTGAATCGCAACAAACCTTAACGCGCACGTTTAAGAACTATTTCGACGTGCCGCCGCATAAATT
CCGCGTGACGGATATCCCGGCAGAGTCCCGGTATCTATTCCCGCTGAATCACGCTTGTTAA

Protein sequence :
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKGSNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKFRVTDIPAESRYLFPLNHAC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-20 46
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-20 46
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_03430 YP_008106536.1 transcriptional regulator CP001918.1.gene2033. Protein 4e-53 93
H650_03430 YP_008106536.1 transcriptional regulator CP000647.1.gene1624. Protein 6e-52 92
H650_03430 YP_008106536.1 transcriptional regulator CP001138.1.gene1637. Protein 3e-52 92
H650_03430 YP_008106536.1 transcriptional regulator BAC0560 Protein 1e-51 92
H650_03430 YP_008106536.1 transcriptional regulator NC_002695.1.917339.p Protein 1e-51 92
H650_03430 YP_008106536.1 transcriptional regulator CP000034.1.gene1596. Protein 2e-51 92
H650_03430 YP_008106536.1 transcriptional regulator NC_010558.1.6276025. Protein 7e-21 46
H650_03430 YP_008106536.1 transcriptional regulator CP001138.1.gene612.p Protein 3e-22 44
H650_03430 YP_008106536.1 transcriptional regulator NC_002695.1.914293.p Protein 2e-19 42
H650_03430 YP_008106536.1 transcriptional regulator CP000034.1.gene4505. Protein 3e-19 42
H650_03430 YP_008106536.1 transcriptional regulator BAC0371 Protein 2e-19 42
H650_03430 YP_008106536.1 transcriptional regulator CP001138.1.gene4488. Protein 6e-20 42
H650_03430 YP_008106536.1 transcriptional regulator CP001918.1.gene327.p Protein 3e-20 42
H650_03430 YP_008106536.1 transcriptional regulator CP000647.1.gene4499. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H650_03430 YP_008106536.1 transcriptional regulator VFG1038 Protein 6e-21 46
H650_03430 YP_008106536.1 transcriptional regulator VFG0585 Protein 5e-20 42