Gene Information

Name : PP4_00380 (PP4_00380)
Accession : YP_008111075.1
Strain : Pseudomonas putida NBRC 14164
Genome accession: NC_021505
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 45092 - 45766 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTCTGGTAATTGAGGATGAAGTAAAAACTGCGGAGTATGTGCGTCAAGGTCTGACGGAATGTGGCTATGTCGT
AGATTGCGTCCACACCGGGTCAGATGGATTATTCTTGGCTAAGCAGCACGAATATGAGCTGATTATCCTGGATATAAATC
TGCCAGAGATGGACGGTTGGCAGGTCCTTGAGTTGTTGCGTCGTAAAAACTGCCCTTCCCGTATCATGATGCTGACGGCG
AGAAGCCGGCTGGCGGATAAGGTCCGGGGGCTGGAGAACGGAGCAGATGACTACCTGATCAAGCCATTTGAGTTCCCTGA
GCTGCTGGCCCGGGTTCGCGCCTTGATGCGCAGGTCAGATCACCCTGCATCCGTAGAGGTCATTCGCGTCGCTGACCTGG
AGCTTGATCAGAGCCGGCACAGGGCATTCAGGGACGGTCAGCGCATTGACCTGACCACGAAAGAATTCGCGTTACTGCAT
TACCTGATGCGTAATACCGGTGTGGTGCTGAGCCGCACCCAAATTATTTCGCAGGTTTGGGATATGAATTTTGACTGCGA
CACAAACGTTGTAGAGGTGTCGATTCGAAGACTCAGAGCCAAGATAGATGACCCTTTCGAGACCAAACTGATACATACGC
TTCGGGGCGTAGGGTATGTGCTTGAAAAACGATAG

Protein sequence :
MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEYELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTA
RSRLADKVRGLENGADDYLIKPFEFPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLH
YLMRNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-55 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-54 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0197 Protein 5e-62 59
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0125 Protein 8e-61 58
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0083 Protein 2e-57 56
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0638 Protein 1e-54 56
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0308 Protein 2e-56 54
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0111 Protein 1e-59 53
PP4_00380 YP_008111075.1 putative two-component response regulator BAC0347 Protein 2e-54 49
PP4_00380 YP_008111075.1 putative two-component response regulator NC_007793.3914065.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_002758.1121390.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_010079.5776364.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_002952.2859858.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_007622.3794948.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_003923.1003417.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_013450.8614146.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator NC_002951.3238224.p0 Protein 1e-34 42
PP4_00380 YP_008111075.1 putative two-component response regulator AE015929.1.gene1106. Protein 4e-30 41
PP4_00380 YP_008111075.1 putative two-component response regulator NC_012469.1.7685629. Protein 4e-31 41
PP4_00380 YP_008111075.1 putative two-component response regulator AE000516.2.gene3505. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP4_00380 YP_008111075.1 putative two-component response regulator VFG0596 Protein 3e-55 55
PP4_00380 YP_008111075.1 putative two-component response regulator VFG1389 Protein 6e-35 45
PP4_00380 YP_008111075.1 putative two-component response regulator VFG1390 Protein 9e-37 42
PP4_00380 YP_008111075.1 putative two-component response regulator VFG1386 Protein 2e-36 41