Gene Information

Name : Lp16_1169 (Lp16_1169)
Accession : YP_008120999.1
Strain : Lactobacillus plantarum 16
Genome accession: NC_021514
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1280261 - 1280947 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAGTCGAATATTAATTATTGAGGATGAAAAAAACCTCGCACGCTTCGTTGAATTAGAATTAAAACACGAAGGCTATGA
TATTCAAGTCGAATATAACGGCCGTAAAGGGTTAGACGCAGCGTTAGCTGAAGATTTTGATGCCATCCTATTAGACCTGA
TGTTACCGGAACTGAACGGTTTGGAAGTCTGCCGGCGGGTTCGTGAAGTCAAGAATACGCCGATTATTATGATGACGGCC
CGTGACTCCGTGATTGATCGAGTTTCCGGCCTGGATCATGGGGCAGATGATTACATTGTTAAGCCATTTGCTATCGAAGA
ATTACTTGCCCGCTTACGAGCACTATTGCGGCGAATCGATTTGGAAAGTGAACAACAAAGCACTAAACAAACGACCGTCA
CTTATAAAGACTTGACGATTGAAAAGGAAAACTTAGTCGTTAAACGCGGCGACGAAGTCATCAACTTGACGAAGCGTGAA
TATGAACTGTTATTAACTTTAATGGAAAATATTAACGTTGTCCTCGCTCGTGATGTCTTACTAAACAAAGTATGGGGTTA
CGAATCAGAAGTTGAAACGAATGTCGTCGACGTTTATATCCGTTACTTACGGAACAAGATTGACCGACCAGGAGAAAAGA
GTTACATCCAAACTGTTCGTGGGACTGGATACGTGATTCGTTCTTAA

Protein sequence :
MSRILIIEDEKNLARFVELELKHEGYDIQVEYNGRKGLDAALAEDFDAILLDLMLPELNGLEVCRRVREVKNTPIIMMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRALLRRIDLESEQQSTKQTTVTYKDLTIEKENLVVKRGDEVINLTKRE
YELLLTLMENINVVLARDVLLNKVWGYESEVETNVVDVYIRYLRNKIDRPGEKSYIQTVRGTGYVIRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-33 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lp16_1169 YP_008120999.1 two-component system response regulator HE999704.1.gene1528. Protein 3e-79 77
Lp16_1169 YP_008120999.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-52 56
Lp16_1169 YP_008120999.1 two-component system response regulator AE015929.1.gene1106. Protein 7e-47 53
Lp16_1169 YP_008120999.1 two-component system response regulator BAC0125 Protein 3e-31 43
Lp16_1169 YP_008120999.1 two-component system response regulator BAC0308 Protein 6e-32 42
Lp16_1169 YP_008120999.1 two-component system response regulator NC_012469.1.7686381. Protein 5e-36 42
Lp16_1169 YP_008120999.1 two-component system response regulator AE000516.2.gene3505. Protein 9e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lp16_1169 YP_008120999.1 two-component system response regulator VFG1390 Protein 6e-39 43
Lp16_1169 YP_008120999.1 two-component system response regulator VFG0596 Protein 1e-33 41