Gene Information

Name : K756_11345 (K756_11345)
Accession : YP_008124912.1
Strain : Haemophilus parasuis ZJ0906
Genome accession: NC_021521
Putative virulence/resistance : Unknown
Product : IS222, family IS3
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2182168 - 2182491 bp
Length : 324 bp
Strand : +
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGCGAAGGCCTAGAAGAACCTTTAGTGCGGAATTTAAAGCCGAAGCGGTAAAATTGATTACCGAGCGTAAATATTCTAT
TACACAAGCTTGCAAAGAGCTAGACATCGGTGAAACAGCGTTGCGTCGCTGGGTAAGTCAAGTTCAAACTGAATGTCAGG
GCTATGTGTTGCTGGGTTCAAAGCCAATCAGTCCTGAACAACAACGCATTCGAGAGTTAGAAAACCGTATCAAAGAGCTG
GAAGAGGATAAAGAAATTCTAAAAAAGGCTACGGCGATTTTAATGTCTCTCGAGAGCAATGATACCAAGCGGTCACGACG
TTAA

Protein sequence :
MRRPRRTFSAEFKAEAVKLITERKYSITQACKELDIGETALRRWVSQVQTECQGYVLLGSKPISPEQQRIRELENRIKEL
EEDKEILKKATAILMSLESNDTKRSRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-15 57
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-12 49
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-12 49
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-12 49
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-12 49
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-12 49
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-12 49
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-12 49
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-12 49
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-12 48
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-12 48
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 9e-13 48
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-12 48
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 1e-12 47
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-09 46
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-10 44
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-12 43
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-12 43
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-12 43
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-12 43
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 8e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
K756_11345 YP_008124912.1 IS222, family IS3 VFG1123 Protein 2e-12 49
K756_11345 YP_008124912.1 IS222, family IS3 VFG1485 Protein 2e-12 48
K756_11345 YP_008124912.1 IS222, family IS3 VFG1553 Protein 6e-10 46
K756_11345 YP_008124912.1 IS222, family IS3 VFG0784 Protein 2e-12 43