Gene Information

Name : SOD_c10120 (SOD_c10120)
Accession : YP_008137213.1
Strain : Serratia odorifera 4Rx13
Genome accession: NC_021591
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1117118 - 1117324 bp
Length : 207 bp
Strand : -
Note : -

DNA sequence :
ATGACGAACGAATACCCCCTACTCAGTGACAAATTTGTTGATATGGCCTTTATCACCAACCTGACGGGCCTGACGAATAA
GTGGTTCTACAAACTGATAAAAGACGGAGACTTTCCGAAACCTATAAAGCTAGGGCGAAGCTCCCGCTGGCTGCAAAGCG
AAGTTCACGTCTGGCTGCAACGTCGTATCGAAGAATCCCGTGCGTAG

Protein sequence :
MTNEYPLLSDKFVDMAFITNLTGLTNKWFYKLIKDGDFPKPIKLGRSSRWLQSEVHVWLQRRIEESRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 2e-20 73
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 5e-20 71
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 5e-20 71
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-19 68
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-19 68
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 9e-20 68
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-19 68
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-17 67
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 3e-17 67
unnamed AAL08466.1 unknown Not tested SRL Protein 1e-19 67
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 3e-13 64
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 3e-13 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SOD_c10120 YP_008137213.1 transcriptional regulatory protein VFG0651 Protein 4e-20 68
SOD_c10120 YP_008137213.1 transcriptional regulatory protein VFG1480 Protein 1e-17 67
SOD_c10120 YP_008137213.1 transcriptional regulatory protein VFG1057 Protein 5e-20 67