Gene Information

Name : SCE1572_12475 (SCE1572_12475)
Accession : YP_008148938.1
Strain : Sorangium cellulosum So0157-2
Genome accession: NC_021658
Putative virulence/resistance : Virulence
Product : chemotaxis protein CheY
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3448475 - 3449161 bp
Length : 687 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGGCGCTGCGGCTCCTGCTCATCGACGACGACTCCAGGCTCCACGCCCTGCTCGCGAGCTACCTCGAGCAGAACGGCTT
CACGGTCACGGTCGCGTGCGACGGCGCGCGAGGCCTCGCGGCGCTCGCCGCGGGCACCTTCGACGCCGTCCTGCTCGACG
TGATGATGCCCGGCATGGACGGCATCGAGGTCGTGCGCCGCATCCGGCAGAAGAGCTCGATGCCGATCCTCATGCTCACC
GCCCGCGGCGACGAGGCCGATCGCGTGGTCGGCCTCGAGATCGGCGCCGACGACTACATCGCCAAGCCGTTCAGCCCGCG
CGAGCTGCTCGCGCGCCTCCGCGCCGTGCTCCGGCGCGCCACGCCCGACGCCGCCGGCGAGCGGATCGTGGCCGGCGACA
TCGCCATCGACGTGCCCGGCCGCGTGGTCACCGTCGCGGGCAAGCCCGCGGAGCTCACCGGCATCGAGTTCGACATCCTC
GTCGCCCTCGCGCGGCGCGCCGGCCGCGTCGTCGCCCGCGAGGCGCTCCTCGAGGAGGCCGGCCGCGGCGACGTCAACGT
CGGCGGGCGGACCGTCGACGTGCACATCTCGCACCTGCGGCAGAAGCTCGCCGACGACCCGAGGTCGCCGAAGCTCATCA
AGACCGTGCGCGGGGTCGGCTACGTGCTCGCCAAGGACCGCGCGTGA

Protein sequence :
MALRLLLIDDDSRLHALLASYLEQNGFTVTVACDGARGLAALAAGTFDAVLLDVMMPGMDGIEVVRRIRQKSSMPILMLT
ARGDEADRVVGLEIGADDYIAKPFSPRELLARLRAVLRRATPDAAGERIVAGDIAIDVPGRVVTVAGKPAELTGIEFDIL
VALARRAGRVVAREALLEEAGRGDVNVGGRTVDVHISHLRQKLADDPRSPKLIKTVRGVGYVLAKDRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-19 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP000675.2.gene1535. Protein 2e-31 48
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY AE000516.2.gene3505. Protein 8e-25 48
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY BAC0125 Protein 8e-24 46
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY AE016830.1.gene1681. Protein 2e-27 46
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_012469.1.7685629. Protein 3e-20 46
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_002952.2859905.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_009641.5332272.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_013450.8614421.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_007793.3914279.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_003923.1003749.p0 Protein 1e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_002745.1124361.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_009782.5559369.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_002951.3237708.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_007622.3794472.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_002758.1121668.p0 Protein 2e-25 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY BAC0533 Protein 3e-20 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_002695.1.915041.p Protein 3e-20 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP000647.1.gene4257. Protein 3e-20 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP000034.1.gene3834. Protein 3e-20 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP001138.1.gene4273. Protein 5e-20 44
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY AF155139.2.orf0.gene Protein 1e-26 43
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY BAC0197 Protein 7e-18 43
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP001918.1.gene5135. Protein 4e-19 43
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP004022.1.gene3215. Protein 2e-22 42
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY FJ349556.1.orf0.gene Protein 2e-26 42
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP000034.1.gene3671. Protein 1e-27 42
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_012469.1.7686381. Protein 1e-23 42
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY HE999704.1.gene2815. Protein 2e-23 42
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY BAC0308 Protein 3e-16 42
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY BAC0083 Protein 2e-20 41
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY CP000034.1.gene2186. Protein 9e-19 41
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY NC_002695.1.916589.p Protein 7e-19 41
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY BAC0039 Protein 9e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY VFG1390 Protein 1e-20 45
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY VFG0596 Protein 8e-20 44
SCE1572_12475 YP_008148938.1 chemotaxis protein CheY VFG1389 Protein 2e-18 43