Gene Information

Name : M621_13415 (M621_13415)
Accession : YP_008159480.1
Strain : Serratia plymuthica S13
Genome accession: NC_021659
Putative virulence/resistance : Resistance
Product : multidrug DMT transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2811583 - 2811915 bp
Length : 333 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGAGCGGATTTATCTATTTGACCATGGCGATTGTTGCGGAAGTGATCGCCACCACCATGTTGAAAGCCTCTGAAGGCTT
TACCCGACTGTGGCCCTCGCTGGTGGTTGTCGTGGGCTACGCCGTGGCGTTCTGGGGGTTGTCAATGGTGGTGAAAACCA
TGCCGCTGGGGATAGTCTATGCTATCTGGTCGGGCATGGGCATTGTTCTGGTGTCGATAGCGGCCGTATTCGTCTATCAG
CAAAAGCTGGATCTGCCTGCGGTGATCGGCATGGTATTAATTATTGCCGGCGTACTGGTGATTAATTTACTGTCGAAAAC
GGCGGCGCATTGA

Protein sequence :
MSGFIYLTMAIVAEVIATTMLKASEGFTRLWPSLVVVVGYAVAFWGLSMVVKTMPLGIVYAIWSGMGIVLVSIAAVFVYQ
QKLDLPAVIGMVLIIAGVLVINLLSKTAAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 5e-17 51
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 5e-17 51
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 5e-17 51
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 7e-17 51
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 5e-17 51
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 5e-17 51
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 7e-17 51
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 5e-17 51
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-17 51
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 7e-17 51
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-17 51
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 7e-17 51
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-17 51
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 7e-17 51
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 5e-17 51
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 5e-17 51
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 5e-17 51
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 5e-17 51
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 5e-17 51
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 5e-17 51
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-20 43
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0377 Protein 7e-41 88
M621_13415 YP_008159480.1 multidrug DMT transporter CP004022.1.gene1549. Protein 1e-36 75
M621_13415 YP_008159480.1 multidrug DMT transporter NC_002695.1.913273.p Protein 6e-26 59
M621_13415 YP_008159480.1 multidrug DMT transporter CP001138.1.gene1489. Protein 2e-23 58
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0150 Protein 8e-26 57
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0002 Protein 7e-22 57
M621_13415 YP_008159480.1 multidrug DMT transporter NC_010410.6003348.p0 Protein 7e-22 57
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0324 Protein 1e-20 56
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0322 Protein 1e-21 54
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0323 Protein 2e-17 51
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0140 Protein 1e-17 46
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0192 Protein 1e-15 44
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0139 Protein 9e-16 42
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0325 Protein 2e-17 42
M621_13415 YP_008159480.1 multidrug DMT transporter BAC0329 Protein 1e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M621_13415 YP_008159480.1 multidrug DMT transporter VFG1586 Protein 4e-21 43
M621_13415 YP_008159480.1 multidrug DMT transporter VFG1587 Protein 9e-13 42