Gene Information

Name : A606_08725 (A606_08725)
Accession : YP_008166250.1
Strain : Corynebacterium terpenotabidum Y-11
Genome accession: NC_021663
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2022952 - 2023626 bp
Length : 675 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCTGCCAAGATTCTCGTCGTTGACGACGACCCTGCGATCTCCGAGATGCTGACCATGGTCCTGCAGGGCGAGGGGTT
CGATACCGTCACCGTCGGGGACGGGGCCGAGGCCGTGGAGGCCGCCCAGCATCAGCACCCCGACCTCATCCTCCTCGACC
TCATGCTTCCCGGGATGAACGGCGTCGATGTCTGCCGGTCCGTCCGCGAGTTCTCCGCTGTCCCGATCGTCATGCTCACC
GCCAAGACGGACACGGTCGACGTCGTCCTCGGTCTCGAATCTGGGGCCGACGACTACGTCCCCAAGCCCTTCAAGCCGAA
GGAGCTCGTCGCCCGCGTCCGCGCCCGGCTGCGACGGATCCCCGAGGGCACCCCGGACACGGCCACCGTCGGCGATGTCA
CCATTGACTTCGGCGGCCACCAGGTCAGCCGTGACGGCCGGACGATCCAGCTCACCCCCATCGAATTTGAGCTGCTCGCG
ACCCTGGCGTCCCGCCCCCGGCAGGTTTTCTCCCGCGAGGAGCTGCTGGAACGGGTCTGGGGCTACCGCAAGAACAGTGA
CACCCGCCTGGTCAACGTCCACATCCAGCGACTGCGGTCCAAGGTGGAGAAGGACCCGGACAACCCGGTGATCATCCAGA
CAGTCCGTGGCGTGGGATACAAGACGGGCGAATAG

Protein sequence :
MAAKILVVDDDPAISEMLTMVLQGEGFDTVTVGDGAEAVEAAQHQHPDLILLDLMLPGMNGVDVCRSVREFSAVPIVMLT
AKTDTVDVVLGLESGADDYVPKPFKPKELVARVRARLRRIPEGTPDTATVGDVTIDFGGHQVSRDGRTIQLTPIEFELLA
TLASRPRQVFSREELLERVWGYRKNSDTRLVNVHIQRLRSKVEKDPDNPVIIQTVRGVGYKTGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A606_08725 YP_008166250.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-70 68
A606_08725 YP_008166250.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_002758.1121668.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_009641.5332272.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_013450.8614421.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_007793.3914279.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_003923.1003749.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_002745.1124361.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_009782.5559369.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_002951.3237708.p0 Protein 6e-44 48
A606_08725 YP_008166250.1 two-component system response regulator NC_012469.1.7686381. Protein 5e-40 45
A606_08725 YP_008166250.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-39 45
A606_08725 YP_008166250.1 two-component system response regulator NC_007622.3794948.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_003923.1003417.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_013450.8614146.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_002951.3238224.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_007793.3914065.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_002758.1121390.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_010079.5776364.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator NC_002952.2859858.p0 Protein 8e-37 44
A606_08725 YP_008166250.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-36 44
A606_08725 YP_008166250.1 two-component system response regulator FJ349556.1.orf0.gene Protein 7e-33 44
A606_08725 YP_008166250.1 two-component system response regulator AE016830.1.gene1681. Protein 1e-40 43
A606_08725 YP_008166250.1 two-component system response regulator HE999704.1.gene2815. Protein 8e-41 43
A606_08725 YP_008166250.1 two-component system response regulator CP000675.2.gene1535. Protein 3e-34 42
A606_08725 YP_008166250.1 two-component system response regulator BAC0125 Protein 2e-29 42
A606_08725 YP_008166250.1 two-component system response regulator BAC0197 Protein 7e-27 42
A606_08725 YP_008166250.1 two-component system response regulator BAC0039 Protein 1e-38 42
A606_08725 YP_008166250.1 two-component system response regulator CP001918.1.gene3444. Protein 6e-37 42
A606_08725 YP_008166250.1 two-component system response regulator BAC0596 Protein 1e-37 42
A606_08725 YP_008166250.1 two-component system response regulator CP000034.1.gene2186. Protein 1e-38 42
A606_08725 YP_008166250.1 two-component system response regulator NC_002695.1.916589.p Protein 1e-38 42
A606_08725 YP_008166250.1 two-component system response regulator CP001138.1.gene2239. Protein 1e-37 42
A606_08725 YP_008166250.1 two-component system response regulator AF162694.1.orf4.gene Protein 1e-29 41
A606_08725 YP_008166250.1 two-component system response regulator HE999704.1.gene1528. Protein 5e-37 41
A606_08725 YP_008166250.1 two-component system response regulator CP001485.1.gene721.p Protein 3e-27 41
A606_08725 YP_008166250.1 two-component system response regulator CP000034.1.gene3671. Protein 3e-35 41
A606_08725 YP_008166250.1 two-component system response regulator CP004022.1.gene1676. Protein 1e-37 41
A606_08725 YP_008166250.1 two-component system response regulator CP000647.1.gene2531. Protein 5e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A606_08725 YP_008166250.1 two-component system response regulator VFG1390 Protein 3e-33 43
A606_08725 YP_008166250.1 two-component system response regulator VFG1389 Protein 4e-28 43
A606_08725 YP_008166250.1 two-component system response regulator VFG1702 Protein 2e-36 42
A606_08725 YP_008166250.1 two-component system response regulator VFG1563 Protein 2e-36 41