Gene Information

Name : I607_13910 (I607_13910)
Accession : YP_008172825.1
Strain : Alteromonas macleodii Ionian Sea U4
Genome accession: NC_021710
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3119172 - 3119561 bp
Length : 390 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGTCAGGGACAATCGGAAAGATTGCAAAACTAATCGGTGTGAATAAAGAAACTATTCGCTTTTATGAGCGCAATGGCTT
AATCAGTCAGCCACAAAAGCCCTCTGAGGGTTATCGATTATATCCTAAGGAAACGGTTGATAGGATCCGATTCATAAAAC
GCGCTCAAGAATTAGGATTTACGCTTAAAGAAATAGAATCTCTGCTGTCGTTAAATAGCGAGTGCTGTAGCAAGGTAGAA
GCGCTAGCAAAACAGAGGCTTGCATCTGTGCAATCTAAGCTGGAAGACCTAAAACAATTAGAGCATGCGCTATTGGAGAG
CATCACTAAGTGTCAGACGAATGATGATGATAGCCATTGCCCCATTATTAATGCCTTGTCACCAAAGTAA

Protein sequence :
MSGTIGKIAKLIGVNKETIRFYERNGLISQPQKPSEGYRLYPKETVDRIRFIKRAQELGFTLKEIESLLSLNSECCSKVE
ALAKQRLASVQSKLEDLKQLEHALLESITKCQTNDDDSHCPIINALSPK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 6e-18 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 8e-18 43
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 2e-16 42
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 3e-16 42
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-17 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-16 42
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-17 42
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-17 42
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-17 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-17 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-17 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-17 42
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0682 Protein 1e-20 46
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 4e-19 43
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 1e-17 43
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 3e-18 43
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 1e-17 43
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 1e-18 42
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 5e-18 42
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 4e-17 42
I607_13910 YP_008172825.1 Hg(II)-responsive transcriptional regulator BAC0680 Protein 2e-16 41