Gene Information

Name : I607_04765 (I607_04765)
Accession : YP_008171019.1
Strain : Alteromonas macleodii Ionian Sea U4
Genome accession: NC_021710
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1066227 - 1066502 bp
Length : 276 bp
Strand : -
Note : COG2608 Copper chaperone

DNA sequence :
ATGAAAAAATTAATAACTTGTTTATTACTTAGCGTGTCGGCGGCGTCTGTTGTGGCAAAAGAACAAACGGTTACGCTGGA
AGTTCCTACCATGAACTGTGTGACCTGTCCGATTACCGTTAAAAAAGCCTTAGAAAACGTTGATGGTGTGAAACTCGCCA
AAGTATCGTATGACACTAAATTAGCGTTGGTAACATTTGATGACGAAAAGGCCACCATCAAAGCACTCACTGATGCCACA
ACGAATGCGGGCTACCCATCCAAGAAAGTTAAGTAG

Protein sequence :
MKKLITCLLLSVSAASVVAKEQTVTLEVPTMNCVTCPITVKKALENVDGVKLAKVSYDTKLALVTFDDEKATIKALTDAT
TNAGYPSKKVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-15 61
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 4e-15 60
merP ABQ57373.1 MerP Not tested SGI1 Protein 4e-15 60
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 4e-15 60
merP AFG30122.1 MerP Not tested PAGI-2 Protein 4e-15 60
merP AGK07023.1 MerP Not tested SGI1 Protein 4e-15 60
merP AGK07081.1 MerP Not tested SGI1 Protein 4e-15 60
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 6e-15 60
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 5e-15 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I607_04765 YP_008171019.1 mercuric transport periplasmic protein BAC0675 Protein 1e-16 64
I607_04765 YP_008171019.1 mercuric transport periplasmic protein BAC0679 Protein 1e-15 58
I607_04765 YP_008171019.1 mercuric transport periplasmic protein BAC0678 Protein 1e-15 58
I607_04765 YP_008171019.1 mercuric transport periplasmic protein BAC0674 Protein 1e-12 54
I607_04765 YP_008171019.1 mercuric transport periplasmic protein BAC0231 Protein 1e-15 53