Gene Information

Name : I634_00805 (I634_00805)
Accession : YP_008174313.1
Strain : Alteromonas macleodii Ionian Sea U8
Genome accession: NC_021712
Putative virulence/resistance : Resistance
Product : Mercury scavenger protein:Heavy-metal-associated domain-containing protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 174805 - 175083 bp
Length : 279 bp
Strand : -
Note : COG2608 Copper chaperone

DNA sequence :
ATGAAAAAACTATTACTTACGATGGCTTTACTTTCAAGCACCACCGCGTGGGCAGAGTTAAAAACAGTCACGCTAGAAGT
ACCTAGCATGAATTGTGTTACTTGTCCCGTTACGGTCAAATTAGCACTGAAAAAAGTGGAAGGTGTGAAAACAGTCGAAG
CCACATATGAGCCAAATGAAGCTATTGTTACTTTCGACGATACGAAAACCAATACAAAAGAGTTAATGGCAGCCACCGAG
AATGCAGGCTATTCGTCTAACGTAAAAAGTAGCGATTAA

Protein sequence :
MKKLLLTMALLSSTTAWAELKTVTLEVPSMNCVTCPVTVKLALKKVEGVKTVEATYEPNEAIVTFDDTKTNTKELMAATE
NAGYSSNVKSSD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 7e-16 60
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-17 59
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-15 58
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-15 58
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-15 58
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-15 58
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-15 58
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-15 58
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-15 56
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-15 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I634_00805 YP_008174313.1 Mercury scavenger protein:Heavy-metal-associated domain-containing protein BAC0231 Protein 6e-16 60
I634_00805 YP_008174313.1 Mercury scavenger protein:Heavy-metal-associated domain-containing protein BAC0679 Protein 3e-16 58
I634_00805 YP_008174313.1 Mercury scavenger protein:Heavy-metal-associated domain-containing protein BAC0678 Protein 1e-15 57
I634_00805 YP_008174313.1 Mercury scavenger protein:Heavy-metal-associated domain-containing protein BAC0675 Protein 9e-14 53
I634_00805 YP_008174313.1 Mercury scavenger protein:Heavy-metal-associated domain-containing protein BAC0674 Protein 4e-13 48