Gene Information

Name : LOCK919_2933 (LOCK919_2933)
Accession : YP_008201413.1
Strain : Lactobacillus casei LOCK919
Genome accession: NC_021721
Putative virulence/resistance : Virulence
Product : Response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2877840 - 2878541 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
TTGAAATCAACATTGCTTCTAGTGGAAGACGAAGCTGCATTGGCAGATTCATTAACAACAGAGTTCGAGTTAGAGAATAT
GTCAGTTATTTGGGCAAAAGACGGCGCGGAGGCATTGACGCTGTTTAAGAACAATGAAGGTAAAATCAATGTCATTATTT
TGGATTGGATGCTGCCTAAACTAGACGGGTTTAGTGTTTTGCGGAAAATCAGACAATCCAGCCAAGTGCCTATTATTATG
TTGACGGCTCGTGACTACATCGGCGACAAGGTGGCTGGACTGACTGGCGGGGCCGATGATTACATCACCAAGCCTTTTGA
AATGGAGGAACTGGTTGCTCGTGTCGAAGTCGCCTTGCGTCACAATCGGCAGGCTGTCTCACCAGCGACTATTTTTCAAG
TCGATGATCTGCTGGTGGATACGGATAACAAACGCGTTCAGCGCGGTGAGGTGATTATGCCATTGACACAGCGCGAATAT
GAGTTGCTTGTCGAACTTGTTGCCCATCAGGACGAAGCTTGTTCGAGGGATGACTTGCTTGATGCCGTCTGGGGAACCGA
CTTTGACGGTCAACCTAATATATTGGATGTCTATATCAGAAACTTACGTCATAAAATTGATGATCATTCAGGTAGCAAGA
AACTCATTCATACTGTTCGCGGCGTCGGCTATATGCTCTCGGCTAATGTTGCATCCATTTAG

Protein sequence :
MKSTLLLVEDEAALADSLTTEFELENMSVIWAKDGAEALTLFKNNEGKINVIILDWMLPKLDGFSVLRKIRQSSQVPIIM
LTARDYIGDKVAGLTGGADDYITKPFEMEELVARVEVALRHNRQAVSPATIFQVDDLLVDTDNKRVQRGEVIMPLTQREY
ELLVELVAHQDEACSRDDLLDAVWGTDFDGQPNILDVYIRNLRHKIDDHSGSKKLIHTVRGVGYMLSANVASI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LOCK919_2933 YP_008201413.1 Response regulator HE999704.1.gene1528. Protein 2e-32 47
LOCK919_2933 YP_008201413.1 Response regulator BAC0083 Protein 2e-30 45
LOCK919_2933 YP_008201413.1 Response regulator BAC0111 Protein 3e-30 44
LOCK919_2933 YP_008201413.1 Response regulator BAC0638 Protein 7e-24 44
LOCK919_2933 YP_008201413.1 Response regulator BAC0308 Protein 4e-28 43
LOCK919_2933 YP_008201413.1 Response regulator NC_007622.3794948.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_003923.1003417.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_013450.8614146.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_002951.3238224.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_007793.3914065.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_002758.1121390.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_010079.5776364.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_002952.2859858.p0 Protein 6e-30 43
LOCK919_2933 YP_008201413.1 Response regulator NC_012469.1.7685629. Protein 5e-31 42
LOCK919_2933 YP_008201413.1 Response regulator BAC0197 Protein 3e-31 42
LOCK919_2933 YP_008201413.1 Response regulator BAC0125 Protein 4e-31 42
LOCK919_2933 YP_008201413.1 Response regulator AE015929.1.gene1106. Protein 6e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LOCK919_2933 YP_008201413.1 Response regulator VFG0596 Protein 3e-31 43
LOCK919_2933 YP_008201413.1 Response regulator VFG1389 Protein 3e-34 43
LOCK919_2933 YP_008201413.1 Response regulator VFG1390 Protein 2e-34 41