Gene Information

Name : lhe_0106 (lhe_0106)
Accession : YP_008235621.1
Strain : Lactobacillus helveticus CNRZ32
Genome accession: NC_021744
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 106944 - 107660 bp
Length : 717 bp
Strand : +
Note : -

DNA sequence :
ATGCCAAAAAAGATTCTCGTCGTCGACGATGAAAAGCCGATTTCTGATATCATTAAATTTAATTTAACTAAGGAAGGCTT
TGATGTCGACACCGCCTATGATGGCGAAGAAGCTGTTAAGAAAGTTGACAAATACGATCCAGACTTAATGATCCTGGATT
TGATGTTACCAAAGAAAGATGGACTCGAGGTTGCTCGTGAAGTTCGTCAAACGCACGATATGCCAATTATCATGGTAACA
GCTAAAGATACTGAAATTGATAAAGTACTTGGTCTAGAAATGGGTGCCGATGACTATGTCACTAAGCCTTTCTCTAATAG
AGAATTAGTTGCCCGCGTTAAGGCTAACTTGCGCCGTCGTGACATTGTTAAGAAGGCAGAAGCAGATAACCAAGACGATA
CAGATAAGAATATTAAGATCGGTAACTTGGTTATCATGCCAGATGCCTATATCGTTGAAAAAGATGGTCGGAAGATTGAG
CTTACTCACCGTGAATTTGAGCTTCTTTACTACTTAGCTCAACATATGGGGCAAGTTATGACTCGTGAACACCTTTTACA
AACTGTTTGGGGCTATGACTACTTTGGCGATGTGCGTACAGTAGACGTAACTGTTCACCGTTTGAGAGAAAAGATTGAAG
ACAACCTAATCCAACCTCAAGTTTTGGTTACTCGTCGTGGTGTAGGATATTACGTAAAACAGCCAAGTGAAGGTTAA

Protein sequence :
MPKKILVVDDEKPISDIIKFNLTKEGFDVDTAYDGEEAVKKVDKYDPDLMILDLMLPKKDGLEVAREVRQTHDMPIIMVT
AKDTEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRRRDIVKKAEADNQDDTDKNIKIGNLVIMPDAYIVEKDGRKIE
LTHREFELLYYLAQHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVHRLREKIEDNLIQPQVLVTRRGVGYYVKQPSEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-31 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lhe_0106 YP_008235621.1 two-component response regulator NC_012469.1.7685629. Protein 2e-64 65
lhe_0106 YP_008235621.1 two-component response regulator NC_002952.2859905.p0 Protein 6e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_013450.8614421.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_007793.3914279.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_002745.1124361.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_009782.5559369.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_002951.3237708.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_003923.1003749.p0 Protein 7e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_002758.1121668.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-49 53
lhe_0106 YP_008235621.1 two-component response regulator NC_009641.5332272.p0 Protein 8e-49 53
lhe_0106 YP_008235621.1 two-component response regulator HE999704.1.gene2815. Protein 1e-42 51
lhe_0106 YP_008235621.1 two-component response regulator AE016830.1.gene1681. Protein 4e-36 46
lhe_0106 YP_008235621.1 two-component response regulator NC_012469.1.7686381. Protein 3e-37 46
lhe_0106 YP_008235621.1 two-component response regulator CP000034.1.gene3834. Protein 7e-33 46
lhe_0106 YP_008235621.1 two-component response regulator NC_002695.1.915041.p Protein 7e-33 46
lhe_0106 YP_008235621.1 two-component response regulator CP001918.1.gene5135. Protein 4e-28 45
lhe_0106 YP_008235621.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-33 44
lhe_0106 YP_008235621.1 two-component response regulator CP000647.1.gene4257. Protein 4e-32 44
lhe_0106 YP_008235621.1 two-component response regulator CP001138.1.gene4273. Protein 5e-32 44
lhe_0106 YP_008235621.1 two-component response regulator BAC0533 Protein 4e-32 44
lhe_0106 YP_008235621.1 two-component response regulator AE000516.2.gene3505. Protein 4e-31 43
lhe_0106 YP_008235621.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-34 43
lhe_0106 YP_008235621.1 two-component response regulator NC_010079.5776364.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_002952.2859858.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_007622.3794948.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_003923.1003417.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_013450.8614146.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_002951.3238224.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_007793.3914065.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_002758.1121390.p0 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator NC_014475.1.orf0.gen Protein 2e-33 42
lhe_0106 YP_008235621.1 two-component response regulator NC_005054.2598277.p0 Protein 2e-33 42
lhe_0106 YP_008235621.1 two-component response regulator AM180355.1.gene1830. Protein 6e-33 42
lhe_0106 YP_008235621.1 two-component response regulator CP004022.1.gene3215. Protein 9e-31 42
lhe_0106 YP_008235621.1 two-component response regulator AE015929.1.gene1106. Protein 2e-26 41
lhe_0106 YP_008235621.1 two-component response regulator NC_010400.5986590.p0 Protein 5e-23 41
lhe_0106 YP_008235621.1 two-component response regulator NC_011595.7057856.p0 Protein 1e-23 41
lhe_0106 YP_008235621.1 two-component response regulator NC_010410.6002989.p0 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lhe_0106 YP_008235621.1 two-component response regulator VFG1563 Protein 6e-32 42
lhe_0106 YP_008235621.1 two-component response regulator VFG1702 Protein 5e-32 42