Gene Information

Name : SEEH1578_14705 (SEEH1578_14705)
Accession : YP_008247000.1
Strain : Salmonella enterica 41578
Genome accession: NC_021810
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2977826 - 2978356 bp
Length : 531 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAAGCAGGCTATGTGGT
TGATTATGCCTGTGATGGACGAGACGGATTACACCTCGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCATGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCGGTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGAGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAHQSPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-79 99
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-78 99

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0197 Protein 4e-43 58
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0083 Protein 1e-39 56
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0638 Protein 2e-35 54
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0347 Protein 4e-39 53
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0111 Protein 4e-40 52
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0125 Protein 1e-40 52
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW BAC0308 Protein 2e-38 52
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 1e-29 42
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 2e-24 41
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW CP001138.1.gene4273. Protein 2e-20 41
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW NC_002695.1.915041.p Protein 2e-20 41
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW CP004022.1.gene3215. Protein 8e-25 41
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW CP000034.1.gene3834. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW VFG0596 Protein 1e-79 99
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW VFG0473 Protein 5e-24 41
SEEH1578_14705 YP_008247000.1 transcriptional regulatory protein YedW VFG1390 Protein 2e-28 41