Gene Information

Name : CFSAN001921_03445 (CFSAN001921_03445)
Accession : YP_008254092.1
Strain : Salmonella enterica CFSAN001921
Genome accession: NC_021814
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 695575 - 695952 bp
Length : 378 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGCAGATTTTACCCTCACTCCCGCCCGGAGCGGCATCGTCACACCCCACGCCTGTCGGCATCTGGCAGTCCCTGCTGTC
GCATCTGCTGCAACAGCATTACGGGCTGATGCTCAACGACACTCCGTTTGCTAACGACGGCGTCATTGAGCAGCATATCG
ACGCCGGCATCTCCCTGTGCGATGCGCTGAACGGTATCGTTGAAAAATATGAACTGGTCCGGACTGACCGTCCCGGATTC
AGTATTGCAGTGCAGTCTCCGTTCATTACTCGTATCGATATTCTCCGCGCCAGAAAAGCCTGTGGCCTGATGAAACGTCG
CGGCTACCGGACTGTTACCGACATCACCACCGGCAGATACAGCGGGGTAGCACGATGA

Protein sequence :
MQILPSLPPGAASSHPTPVGIWQSLLSHLLQQHYGLMLNDTPFANDGVIEQHIDAGISLCDALNGIVEKYELVRTDRPGF
SIAVQSPFITRIDILRARKACGLMKRRGYRTVTDITTGRYSGVAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-28 64
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 2e-27 64
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 3e-28 64
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 2e-27 64
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-27 64
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 2e-27 64
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 9e-28 63
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 3e-27 63
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-27 62
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 7e-27 62
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 1e-26 62
unnamed AAC31486.1 L0007 Not tested LEE Protein 7e-27 62
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 1e-26 62
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 2e-26 62
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-27 62
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 5e-28 61
unnamed AAL08478.1 unknown Not tested SRL Protein 4e-27 61
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 8e-28 61
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 8e-28 61
unnamed AAL57575.1 unknown Not tested LEE Protein 6e-26 61
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 8e-28 60
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-27 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN001921_03445 YP_008254092.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 1e-28 64
CFSAN001921_03445 YP_008254092.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 1e-27 63
CFSAN001921_03445 YP_008254092.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 3e-27 62
CFSAN001921_03445 YP_008254092.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 8e-27 62
CFSAN001921_03445 YP_008254092.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 2e-28 61
CFSAN001921_03445 YP_008254092.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 2e-27 61