Gene Information

Name : CFSAN002050_01400 (CFSAN002050_01400)
Accession : YP_008263075.1
Strain :
Genome accession: NC_021819
Putative virulence/resistance : Resistance
Product : chemical-damaging agent resistance protein C
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 96761 - 97282 bp
Length : 522 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGAAAAACGTCCTGGTGGGCCTTGGCTGGGATGCGCGTTCAACAGACGGTCAGGACTTTGACCTGGATGCTTCAGCATT
CCTGCTGGCCTCAAACGGCAAAGTGCGCGGCGATTCAGATTTCATCTTCTATAACAACCTGACGTCATCCGACGGTTCCG
TAACGCACACCGGCGATAACCGCACCGGTGAGGGCGATGGTGATGATGAATCGCTGAAAATTAAACTGGACGCCGTCCCG
TCTGAAGTTGACAAGATCATCTTCGTTGTGACCATCCACGATGCTCAGGCTCGTCGCCAGAGCTTTGGTCAGGTATCCGG
TGCGTTTATTCGTCTGGTTAATGACGATAACCAGACTGAAGTCGCTCGCTACGATCTGACCGAAGATGCGTCCACTGAGA
CTGCCATGCTGTTCGGCGAGCTGTATCGCCACAATGGTGAGTGGAAATTCCGCGCAGTAGGCCAGGGTTATGCTGGTGGT
CTGGCATCTGTATGTGCTCAGTACGGCATTAACGCGTCCTGA

Protein sequence :
MKNVLVGLGWDARSTDGQDFDLDASAFLLASNGKVRGDSDFIFYNNLTSSDGSVTHTGDNRTGEGDGDDESLKIKLDAVP
SEVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGELYRHNGEWKFRAVGQGYAGG
LASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-75 100
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-75 100
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-75 100
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-60 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-52 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-51 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-20 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN002050_01400 YP_008263075.1 chemical-damaging agent resistance protein C BAC0389 Protein 5e-74 96
CFSAN002050_01400 YP_008263075.1 chemical-damaging agent resistance protein C BAC0390 Protein 1e-56 67
CFSAN002050_01400 YP_008263075.1 chemical-damaging agent resistance protein C BAC0392 Protein 7e-20 41