
|
Name : SEEB0189_05805 (SEEB0189_05805) Accession : YP_008307512.1 Strain : Salmonella enterica CFSAN000189 Genome accession: NC_021844 Putative virulence/resistance : Virulence Product : type III secretion system needle complex protein PrgI Function : - COG functional category : - COG ID : - EC number : - Position : 1126218 - 1126460 bp Length : 243 bp Strand : + Note : with InvG, PrgH, and Prg K makes up the membrane spanning needle complex; Derived by automated computational analysis using gene prediction method: Protein Homology. DNA sequence : ATGGCAACACCTTGGTCAGGCTATCTGGATGACGTCTCAGCAAAATTTGATACGGGCGTTGATAATCTACAAACGCAGGT AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT TAA Protein sequence : MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| prgI | AAX49613.1 | PrgI | Virulence | SPI-1 | Protein | 9e-31 | 100 |
| prgI | YP_217792.1 | cell invasion protein | Virulence | SPI-1 | Protein | 1e-30 | 100 |
| prgI | NP_461794.1 | needle complex major subunit | Virulence | SPI-1 | Protein | 1e-30 | 100 |
| prgI | NP_457267.1 | pathogenicity 1 island effector protein | Virulence | SPI-1 | Protein | 1e-29 | 95 |
| prgI | NP_806476.1 | pathogenicity island 1 effector protein | Virulence | SPI-1 | Protein | 1e-29 | 95 |
| ECs3718 | NP_311745.1 | EprI | Not tested | LIM | Protein | 5e-20 | 63 |
| ysaG | AAS66835.1 | YsaG | Not tested | SSR-1 | Protein | 9e-17 | 53 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| SEEB0189_05805 | YP_008307512.1 | type III secretion system needle complex protein PrgI | VFG0535 | Protein | 4e-31 | 100 |
| SEEB0189_05805 | YP_008307512.1 | type III secretion system needle complex protein PrgI | VFG0996 | Protein | 2e-19 | 69 |
| SEEB0189_05805 | YP_008307512.1 | type III secretion system needle complex protein PrgI | VFG2466 | Protein | 1e-17 | 56 |