Gene Information

Name : SEEB0189_05805 (SEEB0189_05805)
Accession : YP_008307512.1
Strain : Salmonella enterica CFSAN000189
Genome accession: NC_021844
Putative virulence/resistance : Virulence
Product : type III secretion system needle complex protein PrgI
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1126218 - 1126460 bp
Length : 243 bp
Strand : +
Note : with InvG, PrgH, and Prg K makes up the membrane spanning needle complex; Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGGCAACACCTTGGTCAGGCTATCTGGATGACGTCTCAGCAAAATTTGATACGGGCGTTGATAATCTACAAACGCAGGT
AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT
ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT
TAA

Protein sequence :
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
prgI YP_217792.1 cell invasion protein Virulence SPI-1 Protein 1e-30 100
prgI NP_461794.1 needle complex major subunit Virulence SPI-1 Protein 1e-30 100
prgI AAX49613.1 PrgI Virulence SPI-1 Protein 9e-31 100
prgI NP_457267.1 pathogenicity 1 island effector protein Virulence SPI-1 Protein 1e-29 95
prgI NP_806476.1 pathogenicity island 1 effector protein Virulence SPI-1 Protein 1e-29 95
ECs3718 NP_311745.1 EprI Not tested LIM Protein 5e-20 63
ysaG AAS66835.1 YsaG Not tested SSR-1 Protein 9e-17 53

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEB0189_05805 YP_008307512.1 type III secretion system needle complex protein PrgI VFG0535 Protein 4e-31 100
SEEB0189_05805 YP_008307512.1 type III secretion system needle complex protein PrgI VFG0996 Protein 2e-19 69
SEEB0189_05805 YP_008307512.1 type III secretion system needle complex protein PrgI VFG2466 Protein 1e-17 56