Gene Information

Name : SEEB0189_14090 (SEEB0189_14090)
Accession : YP_008309130.1
Strain : Salmonella enterica CFSAN000189
Genome accession: NC_021844
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2851975 - 2852655 bp
Length : 681 bp
Strand : +
Note : response regulator in two-component regulatory system with BasS; Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAAGCAGGCTATGTGGT
TGATTATGCCTGTGATGGACGAGACGGATTGCACCTGGCGCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCATGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCGGTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGAGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACAC
CGTTGATGTCGCGATTCGTCGGCTGCGCGCCAAAGTAGACGATCCATTTGAAAAGAAGCTCATTATGACCGTCCGGGGGA
TGGGTTATCGATTACAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAHQSPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFEKKLIMTVRGMGYRLQAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-103 99
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-102 99

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0083 Protein 5e-56 58
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0197 Protein 3e-59 58
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0125 Protein 1e-59 56
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0638 Protein 2e-52 56
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0308 Protein 3e-54 55
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0111 Protein 6e-57 53
SEEB0189_14090 YP_008309130.1 transcriptional regulator BAC0347 Protein 2e-50 52
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_002758.1121390.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_010079.5776364.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_002952.2859858.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_007622.3794948.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator AE015929.1.gene1106. Protein 8e-34 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_003923.1003417.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_013450.8614146.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_002951.3238224.p0 Protein 1e-39 45
SEEB0189_14090 YP_008309130.1 transcriptional regulator NC_007793.3914065.p0 Protein 1e-39 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEB0189_14090 YP_008309130.1 transcriptional regulator VFG0596 Protein 1e-103 99
SEEB0189_14090 YP_008309130.1 transcriptional regulator VFG0473 Protein 1e-29 42
SEEB0189_14090 YP_008309130.1 transcriptional regulator VFG1389 Protein 4e-32 42
SEEB0189_14090 YP_008309130.1 transcriptional regulator VFG1390 Protein 8e-38 41