Gene Information

Name : A7H1H_0437 (A7H1H_0437)
Accession : YP_008330393.1
Strain : Arcobacter butzleri 7h1h
Genome accession: NC_021878
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 434788 - 435465 bp
Length : 678 bp
Strand : -
Note : Pfam matches to PF00072.19 Response_reg, and to PF00486.23 Trans_reg_C

DNA sequence :
ATGATTTCTATGAAGATACTAATAATTGAAGATGATTTAAAAATCATAAACTTTTTAAAAAAAGGTTTAGAAGAAGAGTG
TTATATAGTTGACTTCTCAACAAATGGTGATGAAGGATTATACTTAGCTAGTATTAACACTTATGATCTAATCTTACTTG
ATATCATGCTTCCAATTAAAGATGGAATTGAAGTATGTAAAAGTTTAAGAAGCTCAAATATTCAAACTCCTATTATTATG
CTAACAGCTAAAGATTCTATTGAAGATAAAATCAAAGGTTTAGATATTGGAGCAAATGATTATTTAGCAAAACCCTTTTC
TTTTGCAGAATTGCTTGCAAGAATTAGAGTTCAATTAAGAATCACAACTACTACTCAAACAAAACTATCTATTGCAGATT
TAGAGCTTGATTTATTAAATAAAACAGCTTCAAGAGCAAATCAAAATATAGTTTTAACAGCCAAAGAGTTTGCACTTTTA
GAGTATCTAATAAAAAATAAAAATCGAGTTCTAAGTGAAACAACAATAAATGAAGCACTTTCATCATTTGAGGATTCAAA
TATCAGTAATATTGTAAATGTTTATATTTATAGGTTAAGAAATAAAATTGATAAAAATTTTGAAAATAAACTAATAAAAA
CAGTAAGAGGAATAGGATTTAAAATCAGTGAAGATTAA

Protein sequence :
MISMKILIIEDDLKIINFLKKGLEEECYIVDFSTNGDEGLYLASINTYDLILLDIMLPIKDGIEVCKSLRSSNIQTPIIM
LTAKDSIEDKIKGLDIGANDYLAKPFSFAELLARIRVQLRITTTTQTKLSIADLELDLLNKTASRANQNIVLTAKEFALL
EYLIKNKNRVLSETTINEALSSFEDSNISNIVNVYIYRLRNKIDKNFENKLIKTVRGIGFKISED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-44 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-43 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0125 Protein 3e-44 46
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0197 Protein 2e-42 46
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0638 Protein 8e-36 45
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0308 Protein 2e-40 45
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0347 Protein 5e-43 44
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0111 Protein 1e-44 44
A7H1H_0437 YP_008330393.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-31 44
A7H1H_0437 YP_008330393.1 two-component system response regulator BAC0083 Protein 6e-42 43
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_002758.1121390.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_010079.5776364.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_002952.2859858.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_007622.3794948.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_003923.1003417.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_013450.8614146.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_002951.3238224.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator NC_007793.3914065.p0 Protein 5e-29 41
A7H1H_0437 YP_008330393.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A7H1H_0437 YP_008330393.1 two-component system response regulator VFG0596 Protein 1e-44 46
A7H1H_0437 YP_008330393.1 two-component system response regulator VFG1390 Protein 1e-37 41