Gene Information

Name : BDL_220 (BDL_220)
Accession : YP_008340400.1
Strain :
Genome accession: NC_021884
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 264474 - 264746 bp
Length : 273 bp
Strand : -
Note : -

DNA sequence :
TTGGCTGCGAAGGTCCAGACCGTGCTGGAGCGAGATCCGTTCAGCGGCCACGTGTTCGTGTTCCGCGGCAAGCGTGGCGA
TCTGGTCAAAGTGTTGTGGTGGAGCGGCGACGGCATGTGTCTGCTGATGAAACGCCTGGAGCGCGGTCGGTTCGTGTGGC
CACGTGCCGATGGTGGCGTGGTGTGCCTGAGCCAGGCGCAACTGTCGATGCTGCTCGAAGGTATCGACTGGCGGCAACCA
GTCCGCACGACGGAGCCGACATCGGCGTTGTAA

Protein sequence :
MAAKVQTVLERDPFSGHVFVFRGKRGDLVKVLWWSGDGMCLLMKRLERGRFVWPRADGGVVCLSQAQLSMLLEGIDWRQP
VRTTEPTSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-28 76
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-24 71
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-24 71
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-24 71
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-24 71
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-24 71
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-24 71
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-24 71
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-24 71
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-24 70
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-24 70
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-24 70
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-24 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-24 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-24 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-24 66
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-24 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-15 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-22 61
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-22 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BDL_220 YP_008340400.1 putative transposase VFG1709 Protein 1e-24 71
BDL_220 YP_008340400.1 putative transposase VFG0792 Protein 1e-24 71
BDL_220 YP_008340400.1 putative transposase VFG1698 Protein 3e-24 70
BDL_220 YP_008340400.1 putative transposase VFG1052 Protein 1e-24 70
BDL_220 YP_008340400.1 putative transposase VFG1665 Protein 6e-25 67
BDL_220 YP_008340400.1 putative transposase VFG1517 Protein 4e-16 66